| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146403.1 | internal | 122 | 3-368(+) |
Amino Acid sequence : | |||
| VRDLFEKAKAKAPCIVFIDEIDAVGRQRGAGMGGGNDEREQTINQLLTEMDGFSGNSGVIVLAATNRPDVLDSALLRPGRFDRQVTVDRPDVAGRVRILEVHSRGKALAKDVDFEKVARR TP | |||
Physicochemical properties | |||
| Number of amino acids: | 122 | ||
| Molecular weight: | 13,328.988 | ||
| Theoretical pI: | 8.102 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 21.875 | ||
| aromaticity | 0.041 | ||
| GRAVY | -0.376 | ||
Secondary Structure Fraction | |||
| Helix | 0.270 | ||
| turn | 0.205 | ||
| sheet | 0.246 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146403.1 | internal | 122 | 3-368(+) |
Amino Acid sequence : | |||
| VRDLFEKAKAKAPCIVFIDEIDAVGRQRGAGMGGGNDEREQTINQLLTEMDGFSGNSGVIVLAATNRPDVLDSALLRPGRFDRQVTVDRPDVAGRVRILEVHSRGKALAKDVDFEKVARR TP | |||
Physicochemical properties | |||
| Number of amino acids: | 122 | ||
| Molecular weight: | 13,328.988 | ||
| Theoretical pI: | 8.102 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 21.875 | ||
| aromaticity | 0.041 | ||
| GRAVY | -0.376 | ||
Secondary Structure Fraction | |||
| Helix | 0.270 | ||
| turn | 0.205 | ||
| sheet | 0.246 | ||