| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146410.1 | internal | 171 | 2-514(+) |
Amino Acid sequence : | |||
| HEKEITLVMKTPEDVLESQGVTPANIEDMLDELQEHVESIDMANDLHSIGGLVPLLGYLKNPNAGIRSKAADVVTTIVQNNPRSQQLVMEAGGLEPLLSNFTVDPNVTVQTKALGAISSL IRNNKPGILAFRLANGYAALRDALGSENARFQRKALNLIQYLLHESDADCS | |||
Physicochemical properties | |||
| Number of amino acids: | 171 | ||
| Molecular weight: | 18,556.842 | ||
| Theoretical pI: | 4.913 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 37.251 | ||
| aromaticity | 0.035 | ||
| GRAVY | -0.161 | ||
Secondary Structure Fraction | |||
| Helix | 0.298 | ||
| turn | 0.251 | ||
| sheet | 0.322 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146410.1 | internal | 171 | 2-514(+) |
Amino Acid sequence : | |||
| HEKEITLVMKTPEDVLESQGVTPANIEDMLDELQEHVESIDMANDLHSIGGLVPLLGYLKNPNAGIRSKAADVVTTIVQNNPRSQQLVMEAGGLEPLLSNFTVDPNVTVQTKALGAISSL IRNNKPGILAFRLANGYAALRDALGSENARFQRKALNLIQYLLHESDADCS | |||
Physicochemical properties | |||
| Number of amino acids: | 171 | ||
| Molecular weight: | 18,556.842 | ||
| Theoretical pI: | 4.913 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 37.251 | ||
| aromaticity | 0.035 | ||
| GRAVY | -0.161 | ||
Secondary Structure Fraction | |||
| Helix | 0.298 | ||
| turn | 0.251 | ||
| sheet | 0.322 | ||