| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146420.1 | internal | 152 | 2-457(+) |
Amino Acid sequence : | |||
| NIFIGGTYTSSAVVEWIFTELIKKPAAMKKAQDEVRSVVGSKGKVEEIDLDQLHYLKCIVKEAMRLHPIAPLLDERETMQHCRVNGYDIPPKTRLIINAFAMGRDANIWKNPDEFYPERF IDSSIDFKGHNFELIPFGAGRRICPGMNIGTL | |||
Physicochemical properties | |||
| Number of amino acids: | 152 | ||
| Molecular weight: | 16,946.525 | ||
| Theoretical pI: | 9.116 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27305 | ||
| Instability index: | 40.122 | ||
| aromaticity | 0.148 | ||
| GRAVY | -0.131 | ||
Secondary Structure Fraction | |||
| Helix | 0.380 | ||
| turn | 0.218 | ||
| sheet | 0.176 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146420.1 | 5prime_partial | 142 | 457-29(-) |
Amino Acid sequence : | |||
| QSSNIHTGTYTTPSAKRYEFEIMTLKINGTINESLRIEFIRIFPNICIPSHRKCIYNQPRFGWYVITIDPTVLHCFSFVKQWSYRMQSHRLLNNTLEIMKLVKVNLLDLPLASDNTSHFV LCFLHCGWFFNELRKYPFYDCR* | |||
Physicochemical properties | |||
| Number of amino acids: | 142 | ||
| Molecular weight: | 16,946.525 | ||
| Theoretical pI: | 9.116 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27305 | ||
| Instability index: | 40.122 | ||
| aromaticity | 0.148 | ||
| GRAVY | -0.131 | ||
Secondary Structure Fraction | |||
| Helix | 0.380 | ||
| turn | 0.218 | ||
| sheet | 0.176 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146420.1 | internal | 152 | 2-457(+) |
Amino Acid sequence : | |||
| NIFIGGTYTSSAVVEWIFTELIKKPAAMKKAQDEVRSVVGSKGKVEEIDLDQLHYLKCIVKEAMRLHPIAPLLDERETMQHCRVNGYDIPPKTRLIINAFAMGRDANIWKNPDEFYPERF IDSSIDFKGHNFELIPFGAGRRICPGMNIGTL | |||
Physicochemical properties | |||
| Number of amino acids: | 152 | ||
| Molecular weight: | 16,946.525 | ||
| Theoretical pI: | 9.116 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27305 | ||
| Instability index: | 40.122 | ||
| aromaticity | 0.148 | ||
| GRAVY | -0.131 | ||
Secondary Structure Fraction | |||
| Helix | 0.380 | ||
| turn | 0.218 | ||
| sheet | 0.176 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146420.1 | 5prime_partial | 142 | 457-29(-) |
Amino Acid sequence : | |||
| QSSNIHTGTYTTPSAKRYEFEIMTLKINGTINESLRIEFIRIFPNICIPSHRKCIYNQPRFGWYVITIDPTVLHCFSFVKQWSYRMQSHRLLNNTLEIMKLVKVNLLDLPLASDNTSHFV LCFLHCGWFFNELRKYPFYDCR* | |||
Physicochemical properties | |||
| Number of amino acids: | 142 | ||
| Molecular weight: | 16,946.525 | ||
| Theoretical pI: | 9.116 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27305 | ||
| Instability index: | 40.122 | ||
| aromaticity | 0.148 | ||
| GRAVY | -0.131 | ||
Secondary Structure Fraction | |||
| Helix | 0.380 | ||
| turn | 0.218 | ||
| sheet | 0.176 | ||