| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146430.1 | complete | 140 | 1-423(+) |
Amino Acid sequence : | |||
| MASKAIDNFREIAEIHHGDDLCKKKCMEMLEEQQLPKGLLPLEDIEEFGYDRASGFMWLIQKKSRTHTFEKIKRRVTYAAEVTAFVEPRRMKKISGVKTKELLLWLSVVEMYFQDVHSSE KLTFRTGTGLSDSFEASAFE* | |||
Physicochemical properties | |||
| Number of amino acids: | 140 | ||
| Molecular weight: | 13,187.140 | ||
| Theoretical pI: | 5.624 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 31.023 | ||
| aromaticity | 0.068 | ||
| GRAVY | 0.099 | ||
Secondary Structure Fraction | |||
| Helix | 0.376 | ||
| turn | 0.188 | ||
| sheet | 0.368 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146430.1 | 3prime_partial | 117 | 351-1(-) |
Amino Acid sequence : | |||
| MNVLKVHLHNREPQEELLRLHPTYLLHPARLDEGGDLSGVRHSALDLLEGVGPALLLNQPHETGSPVVPKLLDVLQREKTFWKLLLFEHFHAFLLAEVIAMVDLGNFAEVVDCFGCH | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 13,187.140 | ||
| Theoretical pI: | 5.624 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 31.023 | ||
| aromaticity | 0.068 | ||
| GRAVY | 0.099 | ||
Secondary Structure Fraction | |||
| Helix | 0.376 | ||
| turn | 0.188 | ||
| sheet | 0.368 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146430.1 | complete | 140 | 1-423(+) |
Amino Acid sequence : | |||
| MASKAIDNFREIAEIHHGDDLCKKKCMEMLEEQQLPKGLLPLEDIEEFGYDRASGFMWLIQKKSRTHTFEKIKRRVTYAAEVTAFVEPRRMKKISGVKTKELLLWLSVVEMYFQDVHSSE KLTFRTGTGLSDSFEASAFE* | |||
Physicochemical properties | |||
| Number of amino acids: | 140 | ||
| Molecular weight: | 13,187.140 | ||
| Theoretical pI: | 5.624 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 31.023 | ||
| aromaticity | 0.068 | ||
| GRAVY | 0.099 | ||
Secondary Structure Fraction | |||
| Helix | 0.376 | ||
| turn | 0.188 | ||
| sheet | 0.368 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146430.1 | 3prime_partial | 117 | 351-1(-) |
Amino Acid sequence : | |||
| MNVLKVHLHNREPQEELLRLHPTYLLHPARLDEGGDLSGVRHSALDLLEGVGPALLLNQPHETGSPVVPKLLDVLQREKTFWKLLLFEHFHAFLLAEVIAMVDLGNFAEVVDCFGCH | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 13,187.140 | ||
| Theoretical pI: | 5.624 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 31.023 | ||
| aromaticity | 0.068 | ||
| GRAVY | 0.099 | ||
Secondary Structure Fraction | |||
| Helix | 0.376 | ||
| turn | 0.188 | ||
| sheet | 0.368 | ||