Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146431.1 | 5prime_partial | 102 | 3-311(+) |
Amino Acid sequence : | |||
TPFMDDHPGGDEVLLAATGKDATNDFEDVGHSNSAREMMDKYFIGQIDASTIPSKRAYVPPQQPTNNADKSSDFVIKILQFLVPILILVLAFGVRHFTKVEE* | |||
Physicochemical properties | |||
Number of amino acids: | 102 | ||
Molecular weight: | 11,279.625 | ||
Theoretical pI: | 4.853 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
Instability index: | 32.616 | ||
aromaticity | 0.088 | ||
GRAVY | -0.204 | ||
Secondary Structure Fraction | |||
Helix | 0.304 | ||
turn | 0.225 | ||
sheet | 0.225 |