| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146431.1 | 5prime_partial | 102 | 3-311(+) |
Amino Acid sequence : | |||
| TPFMDDHPGGDEVLLAATGKDATNDFEDVGHSNSAREMMDKYFIGQIDASTIPSKRAYVPPQQPTNNADKSSDFVIKILQFLVPILILVLAFGVRHFTKVEE* | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 11,279.625 | ||
| Theoretical pI: | 4.853 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 32.616 | ||
| aromaticity | 0.088 | ||
| GRAVY | -0.204 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.225 | ||
| sheet | 0.225 | ||