| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146447.1 | internal | 209 | 2-628(+) |
Amino Acid sequence : | |||
| HETKIWRMRNNGTAAWPFGTQLVWVGGDQFGDHSSADLEIPENGFPVEGELDIAVDFMAPSRPGRYVSYWRMASPSGQKFGQRVWVLIQVDYSRPNTPGTVTHPELNLNLPPGSNGRTGV AIIDVNVAPPDSGFTESDITCTAEELVKSVEEHPSHVVVGDLLDASNDALPHPQPTLADVVPPTTLYPLIDIPSPEVPAADGNQVEQTL | |||
Physicochemical properties | |||
| Number of amino acids: | 209 | ||
| Molecular weight: | 22,639.905 | ||
| Theoretical pI: | 4.431 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33460 | ||
| Instability index: | 36.027 | ||
| aromaticity | 0.072 | ||
| GRAVY | -0.317 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.306 | ||
| sheet | 0.215 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146447.1 | internal | 209 | 2-628(+) |
Amino Acid sequence : | |||
| HETKIWRMRNNGTAAWPFGTQLVWVGGDQFGDHSSADLEIPENGFPVEGELDIAVDFMAPSRPGRYVSYWRMASPSGQKFGQRVWVLIQVDYSRPNTPGTVTHPELNLNLPPGSNGRTGV AIIDVNVAPPDSGFTESDITCTAEELVKSVEEHPSHVVVGDLLDASNDALPHPQPTLADVVPPTTLYPLIDIPSPEVPAADGNQVEQTL | |||
Physicochemical properties | |||
| Number of amino acids: | 209 | ||
| Molecular weight: | 22,639.905 | ||
| Theoretical pI: | 4.431 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33460 | ||
| Instability index: | 36.027 | ||
| aromaticity | 0.072 | ||
| GRAVY | -0.317 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.306 | ||
| sheet | 0.215 | ||