Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146456.1 | 5prime_partial | 154 | 3-467(+) |
Amino Acid sequence : | |||
APMLSALHHLMEDVSGSDSSLEKEKATGPTRSYVRDATAMAYTPLDIKELPDSYVFLVDMPGVKSGEIGVQVEDDNLLVITGERKREDDKDQHHKYLRMERRMGKFMRKFSLPENVDTEN GISAICQDGVLTVTVQKKPPPEPKKPKTIEVKIA* | |||
Physicochemical properties | |||
Number of amino acids: | 154 | ||
Molecular weight: | 17,253.572 | ||
Theoretical pI: | 5.846 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 5960 | ||
Instability index: | 35.292 | ||
aromaticity | 0.045 | ||
GRAVY | -0.605 | ||
Secondary Structure Fraction | |||
Helix | 0.253 | ||
turn | 0.214 | ||
sheet | 0.260 |