| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146456.1 | 5prime_partial | 154 | 3-467(+) |
Amino Acid sequence : | |||
| APMLSALHHLMEDVSGSDSSLEKEKATGPTRSYVRDATAMAYTPLDIKELPDSYVFLVDMPGVKSGEIGVQVEDDNLLVITGERKREDDKDQHHKYLRMERRMGKFMRKFSLPENVDTEN GISAICQDGVLTVTVQKKPPPEPKKPKTIEVKIA* | |||
Physicochemical properties | |||
| Number of amino acids: | 154 | ||
| Molecular weight: | 17,253.572 | ||
| Theoretical pI: | 5.846 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 5960 | ||
| Instability index: | 35.292 | ||
| aromaticity | 0.045 | ||
| GRAVY | -0.605 | ||
Secondary Structure Fraction | |||
| Helix | 0.253 | ||
| turn | 0.214 | ||
| sheet | 0.260 | ||