| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146458.1 | internal | 202 | 2-607(+) |
Amino Acid sequence : | |||
| HEWSDKALHISAINQTKWWFAKRFLHPDIVAEYDYIFLWDEDLGVEHFNPDRYLSIIRREGLEISQPGLDTSKSQLHYRITARRGKGDVHRRIYQFHGGKRCYENSTAPPCTGWVEMMAP VFSRAAWRCVWHMIQNDLIHAWGLDKKLGYCAQGDRSKTVGVVDSEYIVHKGLPTLGGVDESRGSSGSHTNKDRFAVRQRSY | |||
Physicochemical properties | |||
| Number of amino acids: | 202 | ||
| Molecular weight: | 23,392.111 | ||
| Theoretical pI: | 8.862 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 57410 57660 | ||
| Instability index: | 39.443 | ||
| aromaticity | 0.119 | ||
| GRAVY | -0.616 | ||
Secondary Structure Fraction | |||
| Helix | 0.302 | ||
| turn | 0.218 | ||
| sheet | 0.188 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146458.1 | internal | 202 | 2-607(+) |
Amino Acid sequence : | |||
| HEWSDKALHISAINQTKWWFAKRFLHPDIVAEYDYIFLWDEDLGVEHFNPDRYLSIIRREGLEISQPGLDTSKSQLHYRITARRGKGDVHRRIYQFHGGKRCYENSTAPPCTGWVEMMAP VFSRAAWRCVWHMIQNDLIHAWGLDKKLGYCAQGDRSKTVGVVDSEYIVHKGLPTLGGVDESRGSSGSHTNKDRFAVRQRSY | |||
Physicochemical properties | |||
| Number of amino acids: | 202 | ||
| Molecular weight: | 23,392.111 | ||
| Theoretical pI: | 8.862 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 57410 57660 | ||
| Instability index: | 39.443 | ||
| aromaticity | 0.119 | ||
| GRAVY | -0.616 | ||
Secondary Structure Fraction | |||
| Helix | 0.302 | ||
| turn | 0.218 | ||
| sheet | 0.188 | ||