Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146467.1 | 5prime_partial | 109 | 2-331(+) |
Amino Acid sequence : | |||
RTVFGEQMGLSDKDIVALSGGHTLGRCHKDRSGFEGAWTSNPLIFDNSYFTELLAGQKEGLLQLPSDKALLDDPVFRPLVEKYAADEDAFFADYAEAHMKLSELGFAEA* | |||
Physicochemical properties | |||
Number of amino acids: | 109 | ||
Molecular weight: | 12,000.268 | ||
Theoretical pI: | 4.588 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
Instability index: | 32.889 | ||
aromaticity | 0.110 | ||
GRAVY | -0.269 | ||
Secondary Structure Fraction | |||
Helix | 0.294 | ||
turn | 0.211 | ||
sheet | 0.339 |