Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146473.1 | internal | 224 | 1-672(+) |
Amino Acid sequence : | |||
VSVTTMAAPPRKPIDVPFGKNYVPTWAFDHIKYFNGGNEIQLHLDKYTGTGFQSKGSYLFGHFSMQIKLVPGDSAGTVTAFYLSSQNSEHDEIDFEFLGNTTGQPYILQTNVFTGWQGNR EQRIYLWFDPTKDYHSYSVLWNMYQIVFLVDDVPIRVFKNCKELGLRFPFNQPMKIYSSLWNADDWATRGGLVKTNWANAPFVASYRGFHVDGCEASVQAKFCA | |||
Physicochemical properties | |||
Number of amino acids: | 224 | ||
Molecular weight: | 18,374.990 | ||
Theoretical pI: | 6.723 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
Instability index: | 46.284 | ||
aromaticity | 0.048 | ||
GRAVY | -0.104 | ||
Secondary Structure Fraction | |||
Helix | 0.345 | ||
turn | 0.242 | ||
sheet | 0.273 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146473.1 | 5prime_partial | 165 | 672-175(-) |
Amino Acid sequence : | |||
GTELGLDRGLAAVHMESSVRRNERGIGPVGLHQAAPRGPVIRVPKTGVDLHGLVERKTEAQFLAILEHSDGNIIYQEDNLVHVPEDRVGMIVLGWVEPEVNSLLSVSLPSGEHVRLQYIG LTCCVAKKLKVYLIMLRVLRREIESSDSSSRIPWNQFYLHAEVPK* | |||
Physicochemical properties | |||
Number of amino acids: | 165 | ||
Molecular weight: | 18,374.990 | ||
Theoretical pI: | 6.723 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
Instability index: | 46.284 | ||
aromaticity | 0.048 | ||
GRAVY | -0.104 | ||
Secondary Structure Fraction | |||
Helix | 0.345 | ||
turn | 0.242 | ||
sheet | 0.273 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146473.1 | internal | 224 | 1-672(+) |
Amino Acid sequence : | |||
VSVTTMAAPPRKPIDVPFGKNYVPTWAFDHIKYFNGGNEIQLHLDKYTGTGFQSKGSYLFGHFSMQIKLVPGDSAGTVTAFYLSSQNSEHDEIDFEFLGNTTGQPYILQTNVFTGWQGNR EQRIYLWFDPTKDYHSYSVLWNMYQIVFLVDDVPIRVFKNCKELGLRFPFNQPMKIYSSLWNADDWATRGGLVKTNWANAPFVASYRGFHVDGCEASVQAKFCA | |||
Physicochemical properties | |||
Number of amino acids: | 224 | ||
Molecular weight: | 18,374.990 | ||
Theoretical pI: | 6.723 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
Instability index: | 46.284 | ||
aromaticity | 0.048 | ||
GRAVY | -0.104 | ||
Secondary Structure Fraction | |||
Helix | 0.345 | ||
turn | 0.242 | ||
sheet | 0.273 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146473.1 | 5prime_partial | 165 | 672-175(-) |
Amino Acid sequence : | |||
GTELGLDRGLAAVHMESSVRRNERGIGPVGLHQAAPRGPVIRVPKTGVDLHGLVERKTEAQFLAILEHSDGNIIYQEDNLVHVPEDRVGMIVLGWVEPEVNSLLSVSLPSGEHVRLQYIG LTCCVAKKLKVYLIMLRVLRREIESSDSSSRIPWNQFYLHAEVPK* | |||
Physicochemical properties | |||
Number of amino acids: | 165 | ||
Molecular weight: | 18,374.990 | ||
Theoretical pI: | 6.723 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
Instability index: | 46.284 | ||
aromaticity | 0.048 | ||
GRAVY | -0.104 | ||
Secondary Structure Fraction | |||
Helix | 0.345 | ||
turn | 0.242 | ||
sheet | 0.273 |