| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146478.1 | internal | 165 | 1-495(+) |
Amino Acid sequence : | |||
| TGKIGQSVLEYTKSDLEHILGVNLIGPFLGTKHAARVMIPARCRGSIISMSSIASVNAGITPHGYACSKHGVVGLTKCAAFELGTHGIRVNCVSPQLLSTPLTTGFYNRTEEEVEAVTAS VANLKGIIFRAEDVANAVLYLASDESAYVSGQNLVVDGGYSVGNP | |||
Physicochemical properties | |||
| Number of amino acids: | 165 | ||
| Molecular weight: | 17,251.472 | ||
| Theoretical pI: | 6.470 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 9190 | ||
| Instability index: | 26.693 | ||
| aromaticity | 0.061 | ||
| GRAVY | 0.201 | ||
Secondary Structure Fraction | |||
| Helix | 0.315 | ||
| turn | 0.285 | ||
| sheet | 0.248 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146478.1 | internal | 165 | 1-495(+) |
Amino Acid sequence : | |||
| TGKIGQSVLEYTKSDLEHILGVNLIGPFLGTKHAARVMIPARCRGSIISMSSIASVNAGITPHGYACSKHGVVGLTKCAAFELGTHGIRVNCVSPQLLSTPLTTGFYNRTEEEVEAVTAS VANLKGIIFRAEDVANAVLYLASDESAYVSGQNLVVDGGYSVGNP | |||
Physicochemical properties | |||
| Number of amino acids: | 165 | ||
| Molecular weight: | 17,251.472 | ||
| Theoretical pI: | 6.470 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 9190 | ||
| Instability index: | 26.693 | ||
| aromaticity | 0.061 | ||
| GRAVY | 0.201 | ||
Secondary Structure Fraction | |||
| Helix | 0.315 | ||
| turn | 0.285 | ||
| sheet | 0.248 | ||