| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146499.1 | 3prime_partial | 149 | 32-478(+) |
Amino Acid sequence : | |||
| MGKGTEAFPDLGEHCEKENCNQLDFLPFTCAGCQKVFCLEHRTYKAHDCPKSEHRSRTVVICEICSLSIEKKGAEEEKAVLERHAKSADCDPTKKMTKPKCPVKRCKELLTFSNTNTCKA CNTNVCLKHRFPSDHSCTNLLLLPTMRKG | |||
Physicochemical properties | |||
| Number of amino acids: | 149 | ||
| Molecular weight: | 16,792.348 | ||
| Theoretical pI: | 8.605 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 2365 | ||
| Instability index: | 38.636 | ||
| aromaticity | 0.047 | ||
| GRAVY | -0.610 | ||
Secondary Structure Fraction | |||
| Helix | 0.195 | ||
| turn | 0.195 | ||
| sheet | 0.248 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146499.1 | 3prime_partial | 149 | 32-478(+) |
Amino Acid sequence : | |||
| MGKGTEAFPDLGEHCEKENCNQLDFLPFTCAGCQKVFCLEHRTYKAHDCPKSEHRSRTVVICEICSLSIEKKGAEEEKAVLERHAKSADCDPTKKMTKPKCPVKRCKELLTFSNTNTCKA CNTNVCLKHRFPSDHSCTNLLLLPTMRKG | |||
Physicochemical properties | |||
| Number of amino acids: | 149 | ||
| Molecular weight: | 16,792.348 | ||
| Theoretical pI: | 8.605 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 2365 | ||
| Instability index: | 38.636 | ||
| aromaticity | 0.047 | ||
| GRAVY | -0.610 | ||
Secondary Structure Fraction | |||
| Helix | 0.195 | ||
| turn | 0.195 | ||
| sheet | 0.248 | ||