| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146517.1 | internal | 99 | 299-3(-) |
Amino Acid sequence : | |||
| ERGIGPVGLHQAAPRGPVIRVPKTGVDLHGLVERKTEAQFLAILEHSDGNIIYQEDNLVHVPEDRVGMIVLGWVEPEVNSLLSVSLPSGEHVRLQYIGL | |||
Physicochemical properties | |||
| Number of amino acids: | 99 | ||
| Molecular weight: | 11,870.397 | ||
| Theoretical pI: | 8.803 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 41940 41940 | ||
| Instability index: | 34.231 | ||
| aromaticity | 0.192 | ||
| GRAVY | -0.387 | ||
Secondary Structure Fraction | |||
| Helix | 0.394 | ||
| turn | 0.232 | ||
| sheet | 0.162 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146517.1 | internal | 99 | 3-299(+) |
Amino Acid sequence : | |||
| QPYILQTNVFTGWQGNREQRIYLWFDPTKDYHSYSVLWNMYQIVFLVDDVPIRVFKNCKELGLRFPFNQPMKIYSSLWNADDWATRGGLVKTNWANAPF | |||
Physicochemical properties | |||
| Number of amino acids: | 99 | ||
| Molecular weight: | 11,870.397 | ||
| Theoretical pI: | 8.803 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 41940 41940 | ||
| Instability index: | 34.231 | ||
| aromaticity | 0.192 | ||
| GRAVY | -0.387 | ||
Secondary Structure Fraction | |||
| Helix | 0.394 | ||
| turn | 0.232 | ||
| sheet | 0.162 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146517.1 | internal | 99 | 299-3(-) |
Amino Acid sequence : | |||
| ERGIGPVGLHQAAPRGPVIRVPKTGVDLHGLVERKTEAQFLAILEHSDGNIIYQEDNLVHVPEDRVGMIVLGWVEPEVNSLLSVSLPSGEHVRLQYIGL | |||
Physicochemical properties | |||
| Number of amino acids: | 99 | ||
| Molecular weight: | 11,870.397 | ||
| Theoretical pI: | 8.803 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 41940 41940 | ||
| Instability index: | 34.231 | ||
| aromaticity | 0.192 | ||
| GRAVY | -0.387 | ||
Secondary Structure Fraction | |||
| Helix | 0.394 | ||
| turn | 0.232 | ||
| sheet | 0.162 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146517.1 | internal | 99 | 3-299(+) |
Amino Acid sequence : | |||
| QPYILQTNVFTGWQGNREQRIYLWFDPTKDYHSYSVLWNMYQIVFLVDDVPIRVFKNCKELGLRFPFNQPMKIYSSLWNADDWATRGGLVKTNWANAPF | |||
Physicochemical properties | |||
| Number of amino acids: | 99 | ||
| Molecular weight: | 11,870.397 | ||
| Theoretical pI: | 8.803 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 41940 41940 | ||
| Instability index: | 34.231 | ||
| aromaticity | 0.192 | ||
| GRAVY | -0.387 | ||
Secondary Structure Fraction | |||
| Helix | 0.394 | ||
| turn | 0.232 | ||
| sheet | 0.162 | ||