| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146527.1 | internal | 160 | 2-481(+) |
Amino Acid sequence : | |||
| IRKKGELRKRRIFSPQKMAPIAVGDSIPDGTLAWFDDNDELKQVSIHSLAAGKKVILFGVPGAFTPTCSMQHVPGFITSADELKSKGVDEILLVSVNDPFVMKAWAKTYPDNKHVKFLAD GSGTYTHALGLELDLSEKGLGTRSRRFALLADDLKVKVAN | |||
Physicochemical properties | |||
| Number of amino acids: | 160 | ||
| Molecular weight: | 11,048.771 | ||
| Theoretical pI: | 9.415 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
| Instability index: | 55.123 | ||
| aromaticity | 0.098 | ||
| GRAVY | 0.306 | ||
Secondary Structure Fraction | |||
| Helix | 0.324 | ||
| turn | 0.314 | ||
| sheet | 0.225 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146527.1 | 3prime_partial | 102 | 306-1(-) |
Amino Acid sequence : | |||
| MTKGSFTLTRRISSTPLDFNSSALVINPGTCCILQVGVKAPGTPKRMTFLPAAREWIETCFSSSLSSNHARVPSGIESPTAIGAIFWGEKILLFLNSPFFLI | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 11,048.771 | ||
| Theoretical pI: | 9.415 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
| Instability index: | 55.123 | ||
| aromaticity | 0.098 | ||
| GRAVY | 0.306 | ||
Secondary Structure Fraction | |||
| Helix | 0.324 | ||
| turn | 0.314 | ||
| sheet | 0.225 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146527.1 | internal | 160 | 2-481(+) |
Amino Acid sequence : | |||
| IRKKGELRKRRIFSPQKMAPIAVGDSIPDGTLAWFDDNDELKQVSIHSLAAGKKVILFGVPGAFTPTCSMQHVPGFITSADELKSKGVDEILLVSVNDPFVMKAWAKTYPDNKHVKFLAD GSGTYTHALGLELDLSEKGLGTRSRRFALLADDLKVKVAN | |||
Physicochemical properties | |||
| Number of amino acids: | 160 | ||
| Molecular weight: | 11,048.771 | ||
| Theoretical pI: | 9.415 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
| Instability index: | 55.123 | ||
| aromaticity | 0.098 | ||
| GRAVY | 0.306 | ||
Secondary Structure Fraction | |||
| Helix | 0.324 | ||
| turn | 0.314 | ||
| sheet | 0.225 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146527.1 | 3prime_partial | 102 | 306-1(-) |
Amino Acid sequence : | |||
| MTKGSFTLTRRISSTPLDFNSSALVINPGTCCILQVGVKAPGTPKRMTFLPAAREWIETCFSSSLSSNHARVPSGIESPTAIGAIFWGEKILLFLNSPFFLI | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 11,048.771 | ||
| Theoretical pI: | 9.415 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
| Instability index: | 55.123 | ||
| aromaticity | 0.098 | ||
| GRAVY | 0.306 | ||
Secondary Structure Fraction | |||
| Helix | 0.324 | ||
| turn | 0.314 | ||
| sheet | 0.225 | ||