Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146541.1 | internal | 193 | 3-581(+) |
Amino Acid sequence : | |||
GIFLCLVLVLVLTSRNVDGKKEKKCDKGWECSDSAFCCNETITDYFQVYQFEDFFSKRNTPVAHAVGFWDYHSFITAAALYEPLGFGTTGGKEMGMKEVSAFLGHVGSQTSCGYGVATGG PLSWGLCYNHEMSPSQSYCNPDYLYPCTPGAEYYGRGAIPVFWNYNYGLIGDGIKVDLLNHPEYLEQNATLAF | |||
Physicochemical properties | |||
Number of amino acids: | 193 | ||
Molecular weight: | 21,384.864 | ||
Theoretical pI: | 4.984 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 42860 43360 | ||
Instability index: | 27.797 | ||
aromaticity | 0.155 | ||
GRAVY | -0.126 | ||
Secondary Structure Fraction | |||
Helix | 0.332 | ||
turn | 0.269 | ||
sheet | 0.218 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146541.1 | internal | 193 | 3-581(+) |
Amino Acid sequence : | |||
GIFLCLVLVLVLTSRNVDGKKEKKCDKGWECSDSAFCCNETITDYFQVYQFEDFFSKRNTPVAHAVGFWDYHSFITAAALYEPLGFGTTGGKEMGMKEVSAFLGHVGSQTSCGYGVATGG PLSWGLCYNHEMSPSQSYCNPDYLYPCTPGAEYYGRGAIPVFWNYNYGLIGDGIKVDLLNHPEYLEQNATLAF | |||
Physicochemical properties | |||
Number of amino acids: | 193 | ||
Molecular weight: | 21,384.864 | ||
Theoretical pI: | 4.984 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 42860 43360 | ||
Instability index: | 27.797 | ||
aromaticity | 0.155 | ||
GRAVY | -0.126 | ||
Secondary Structure Fraction | |||
Helix | 0.332 | ||
turn | 0.269 | ||
sheet | 0.218 |