| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146541.1 | internal | 193 | 3-581(+) |
Amino Acid sequence : | |||
| GIFLCLVLVLVLTSRNVDGKKEKKCDKGWECSDSAFCCNETITDYFQVYQFEDFFSKRNTPVAHAVGFWDYHSFITAAALYEPLGFGTTGGKEMGMKEVSAFLGHVGSQTSCGYGVATGG PLSWGLCYNHEMSPSQSYCNPDYLYPCTPGAEYYGRGAIPVFWNYNYGLIGDGIKVDLLNHPEYLEQNATLAF | |||
Physicochemical properties | |||
| Number of amino acids: | 193 | ||
| Molecular weight: | 21,384.864 | ||
| Theoretical pI: | 4.984 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 42860 43360 | ||
| Instability index: | 27.797 | ||
| aromaticity | 0.155 | ||
| GRAVY | -0.126 | ||
Secondary Structure Fraction | |||
| Helix | 0.332 | ||
| turn | 0.269 | ||
| sheet | 0.218 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146541.1 | internal | 193 | 3-581(+) |
Amino Acid sequence : | |||
| GIFLCLVLVLVLTSRNVDGKKEKKCDKGWECSDSAFCCNETITDYFQVYQFEDFFSKRNTPVAHAVGFWDYHSFITAAALYEPLGFGTTGGKEMGMKEVSAFLGHVGSQTSCGYGVATGG PLSWGLCYNHEMSPSQSYCNPDYLYPCTPGAEYYGRGAIPVFWNYNYGLIGDGIKVDLLNHPEYLEQNATLAF | |||
Physicochemical properties | |||
| Number of amino acids: | 193 | ||
| Molecular weight: | 21,384.864 | ||
| Theoretical pI: | 4.984 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 42860 43360 | ||
| Instability index: | 27.797 | ||
| aromaticity | 0.155 | ||
| GRAVY | -0.126 | ||
Secondary Structure Fraction | |||
| Helix | 0.332 | ||
| turn | 0.269 | ||
| sheet | 0.218 | ||