Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146542.1 | internal | 173 | 3-521(+) |
Amino Acid sequence : | |||
GEDVVHPLKVSLEDLYNGISKKLSLSRNVICSKCKGKGSKSGASMKCAGCQGSGMKVSIRQLGPSMIQQMQHACNDCKGTGEMISDKDRCPQCKGEKVVQEKKVLEVVVEKGMQNGQKIT FPGEADEAPDCVTGDIVFVLQQKDHPKFKRKGDDLFYEHTLSLTEALCGFQFV | |||
Physicochemical properties | |||
Number of amino acids: | 173 | ||
Molecular weight: | 18,901.670 | ||
Theoretical pI: | 8.310 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3605 | ||
Instability index: | 13.271 | ||
aromaticity | 0.046 | ||
GRAVY | -0.433 | ||
Secondary Structure Fraction | |||
Helix | 0.243 | ||
turn | 0.237 | ||
sheet | 0.202 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146542.1 | internal | 173 | 3-521(+) |
Amino Acid sequence : | |||
GEDVVHPLKVSLEDLYNGISKKLSLSRNVICSKCKGKGSKSGASMKCAGCQGSGMKVSIRQLGPSMIQQMQHACNDCKGTGEMISDKDRCPQCKGEKVVQEKKVLEVVVEKGMQNGQKIT FPGEADEAPDCVTGDIVFVLQQKDHPKFKRKGDDLFYEHTLSLTEALCGFQFV | |||
Physicochemical properties | |||
Number of amino acids: | 173 | ||
Molecular weight: | 18,901.670 | ||
Theoretical pI: | 8.310 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3605 | ||
Instability index: | 13.271 | ||
aromaticity | 0.046 | ||
GRAVY | -0.433 | ||
Secondary Structure Fraction | |||
Helix | 0.243 | ||
turn | 0.237 | ||
sheet | 0.202 |