| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146552.1 | internal | 229 | 3-689(+) |
Amino Acid sequence : | |||
| SNMREIEWPASLDEYQKLVMDMNTPRVVIDNAVCRNATLVQVDSARKHGVLLEAVQVLTDLNLSIRKAYISSDGRWFMDVFHVTDSDGRKLHDESIISYIEQSLNSAGMEYSYYDREASD SSVLLTTLELTGTDRPGLLSEVFAVMLDLNCAITDARLWTHNGRIASLLFVKNMDSDKIGLVTARLKNVLNRDHDARGAKISLSTVAIDQADRRLHQMMFDDRDYESMP | |||
Physicochemical properties | |||
| Number of amino acids: | 229 | ||
| Molecular weight: | 18,427.600 | ||
| Theoretical pI: | 11.856 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 83.190 | ||
| aromaticity | 0.058 | ||
| GRAVY | -1.390 | ||
Secondary Structure Fraction | |||
| Helix | 0.195 | ||
| turn | 0.234 | ||
| sheet | 0.169 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146552.1 | 3prime_partial | 154 | 227-688(+) |
Amino Acid sequence : | |||
| MVHGRIPRHRLRRPEAPRREHHLLHRAIPQLRRHGIFLLRQRSIRFLRPFDHSRAHRHRSTRPSLGSFRGDVRPQLRDYGRQAVDPQRENCITPVRQEHGFRQDRPRHGSAEECSQPGPR RERGKDFTFYGRHRPSRSEAPPDDVRRQGLRVHA | |||
Physicochemical properties | |||
| Number of amino acids: | 154 | ||
| Molecular weight: | 18,427.600 | ||
| Theoretical pI: | 11.856 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 83.190 | ||
| aromaticity | 0.058 | ||
| GRAVY | -1.390 | ||
Secondary Structure Fraction | |||
| Helix | 0.195 | ||
| turn | 0.234 | ||
| sheet | 0.169 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146552.1 | internal | 229 | 3-689(+) |
Amino Acid sequence : | |||
| SNMREIEWPASLDEYQKLVMDMNTPRVVIDNAVCRNATLVQVDSARKHGVLLEAVQVLTDLNLSIRKAYISSDGRWFMDVFHVTDSDGRKLHDESIISYIEQSLNSAGMEYSYYDREASD SSVLLTTLELTGTDRPGLLSEVFAVMLDLNCAITDARLWTHNGRIASLLFVKNMDSDKIGLVTARLKNVLNRDHDARGAKISLSTVAIDQADRRLHQMMFDDRDYESMP | |||
Physicochemical properties | |||
| Number of amino acids: | 229 | ||
| Molecular weight: | 18,427.600 | ||
| Theoretical pI: | 11.856 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 83.190 | ||
| aromaticity | 0.058 | ||
| GRAVY | -1.390 | ||
Secondary Structure Fraction | |||
| Helix | 0.195 | ||
| turn | 0.234 | ||
| sheet | 0.169 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146552.1 | 3prime_partial | 154 | 227-688(+) |
Amino Acid sequence : | |||
| MVHGRIPRHRLRRPEAPRREHHLLHRAIPQLRRHGIFLLRQRSIRFLRPFDHSRAHRHRSTRPSLGSFRGDVRPQLRDYGRQAVDPQRENCITPVRQEHGFRQDRPRHGSAEECSQPGPR RERGKDFTFYGRHRPSRSEAPPDDVRRQGLRVHA | |||
Physicochemical properties | |||
| Number of amino acids: | 154 | ||
| Molecular weight: | 18,427.600 | ||
| Theoretical pI: | 11.856 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 83.190 | ||
| aromaticity | 0.058 | ||
| GRAVY | -1.390 | ||
Secondary Structure Fraction | |||
| Helix | 0.195 | ||
| turn | 0.234 | ||
| sheet | 0.169 | ||