Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146558.1 | 5prime_partial | 110 | 1-333(+) |
Amino Acid sequence : | |||
ARAADAIIFKWVLMCWTDEQCVTILKHCKEAIPSKEKGGKVMIIDKVIDANVVNHKVTEVQLYFDMQMLMHTGGKQRTEAEWNKLFIEAGFKEYEILSGMGLRSIIVIYP* | |||
Physicochemical properties | |||
Number of amino acids: | 110 | ||
Molecular weight: | 12,604.760 | ||
Theoretical pI: | 7.041 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21095 | ||
Instability index: | 30.597 | ||
aromaticity | 0.091 | ||
GRAVY | 0.045 | ||
Secondary Structure Fraction | |||
Helix | 0.345 | ||
turn | 0.136 | ||
sheet | 0.273 |