Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146560.1 | 5prime_partial | 168 | 3-509(+) |
Amino Acid sequence : | |||
TRKIPNPKKSQPKMPPFFLLFFSFSLCSASASNSTSIYDLLPKYGLPPGLLPDSVKSFSLSKNGSFDVQLESKCYVDFDYLVYFDANISGVLKYGSIRDLKGIQARKLLIWFDVDAIKVD LPPADYVYFEVGWITKKLKMDQFMDVHSCKNDKLLAQLVEETSMLITE* | |||
Physicochemical properties | |||
Number of amino acids: | 168 | ||
Molecular weight: | 19,071.949 | ||
Theoretical pI: | 7.552 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 23045 | ||
Instability index: | 29.643 | ||
aromaticity | 0.131 | ||
GRAVY | -0.043 | ||
Secondary Structure Fraction | |||
Helix | 0.375 | ||
turn | 0.244 | ||
sheet | 0.220 |