| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146560.1 | 5prime_partial | 168 | 3-509(+) |
Amino Acid sequence : | |||
| TRKIPNPKKSQPKMPPFFLLFFSFSLCSASASNSTSIYDLLPKYGLPPGLLPDSVKSFSLSKNGSFDVQLESKCYVDFDYLVYFDANISGVLKYGSIRDLKGIQARKLLIWFDVDAIKVD LPPADYVYFEVGWITKKLKMDQFMDVHSCKNDKLLAQLVEETSMLITE* | |||
Physicochemical properties | |||
| Number of amino acids: | 168 | ||
| Molecular weight: | 19,071.949 | ||
| Theoretical pI: | 7.552 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 23045 | ||
| Instability index: | 29.643 | ||
| aromaticity | 0.131 | ||
| GRAVY | -0.043 | ||
Secondary Structure Fraction | |||
| Helix | 0.375 | ||
| turn | 0.244 | ||
| sheet | 0.220 | ||