Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146575.1 | internal | 229 | 1-687(+) |
Amino Acid sequence : | |||
AEFDRLPRLLSAALKSRKDQIIKRTRLTVCEGEDGTESSNGDVLIFPEMIRYRRLTHFDIDNFVEEVLVKETQWLPGAVETLTGSYVFVCAHGSRDRRCGACGPVLVTKFKEEINLRGLQ GQVSVSPCSHIGGHKYAGNVIIFSPNPNGEVTGHWYGYVTPEDVPVLLEQHIGKGEIIGHLWRGQMGLSEEEQKEAQELRLQLSIGSEDKIAKGALQETDAADSIANAT | |||
Physicochemical properties | |||
Number of amino acids: | 229 | ||
Molecular weight: | 25,316.321 | ||
Theoretical pI: | 5.429 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24200 | ||
Instability index: | 47.277 | ||
aromaticity | 0.066 | ||
GRAVY | -0.331 | ||
Secondary Structure Fraction | |||
Helix | 0.297 | ||
turn | 0.231 | ||
sheet | 0.258 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146575.1 | internal | 229 | 1-687(+) |
Amino Acid sequence : | |||
AEFDRLPRLLSAALKSRKDQIIKRTRLTVCEGEDGTESSNGDVLIFPEMIRYRRLTHFDIDNFVEEVLVKETQWLPGAVETLTGSYVFVCAHGSRDRRCGACGPVLVTKFKEEINLRGLQ GQVSVSPCSHIGGHKYAGNVIIFSPNPNGEVTGHWYGYVTPEDVPVLLEQHIGKGEIIGHLWRGQMGLSEEEQKEAQELRLQLSIGSEDKIAKGALQETDAADSIANAT | |||
Physicochemical properties | |||
Number of amino acids: | 229 | ||
Molecular weight: | 25,316.321 | ||
Theoretical pI: | 5.429 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24200 | ||
Instability index: | 47.277 | ||
aromaticity | 0.066 | ||
GRAVY | -0.331 | ||
Secondary Structure Fraction | |||
Helix | 0.297 | ||
turn | 0.231 | ||
sheet | 0.258 |