| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146575.1 | internal | 229 | 1-687(+) |
Amino Acid sequence : | |||
| AEFDRLPRLLSAALKSRKDQIIKRTRLTVCEGEDGTESSNGDVLIFPEMIRYRRLTHFDIDNFVEEVLVKETQWLPGAVETLTGSYVFVCAHGSRDRRCGACGPVLVTKFKEEINLRGLQ GQVSVSPCSHIGGHKYAGNVIIFSPNPNGEVTGHWYGYVTPEDVPVLLEQHIGKGEIIGHLWRGQMGLSEEEQKEAQELRLQLSIGSEDKIAKGALQETDAADSIANAT | |||
Physicochemical properties | |||
| Number of amino acids: | 229 | ||
| Molecular weight: | 25,316.321 | ||
| Theoretical pI: | 5.429 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24200 | ||
| Instability index: | 47.277 | ||
| aromaticity | 0.066 | ||
| GRAVY | -0.331 | ||
Secondary Structure Fraction | |||
| Helix | 0.297 | ||
| turn | 0.231 | ||
| sheet | 0.258 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146575.1 | internal | 229 | 1-687(+) |
Amino Acid sequence : | |||
| AEFDRLPRLLSAALKSRKDQIIKRTRLTVCEGEDGTESSNGDVLIFPEMIRYRRLTHFDIDNFVEEVLVKETQWLPGAVETLTGSYVFVCAHGSRDRRCGACGPVLVTKFKEEINLRGLQ GQVSVSPCSHIGGHKYAGNVIIFSPNPNGEVTGHWYGYVTPEDVPVLLEQHIGKGEIIGHLWRGQMGLSEEEQKEAQELRLQLSIGSEDKIAKGALQETDAADSIANAT | |||
Physicochemical properties | |||
| Number of amino acids: | 229 | ||
| Molecular weight: | 25,316.321 | ||
| Theoretical pI: | 5.429 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24200 | ||
| Instability index: | 47.277 | ||
| aromaticity | 0.066 | ||
| GRAVY | -0.331 | ||
Secondary Structure Fraction | |||
| Helix | 0.297 | ||
| turn | 0.231 | ||
| sheet | 0.258 | ||