Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146580.1 | 5prime_partial | 174 | 2-526(+) |
Amino Acid sequence : | |||
PEKMSIVPSGFGFGLGSRPSNILDPLSLDLWDPFDRCPFLHDFLSTSTPSLNFPGETSALANTRVDWKETPRAHVFRVDLPGIKKEEVKVEVEEGRVLQISGERSKEKDEEEGEESRWHR VERSSGKFTRRFRLPENAKLDQVKATMEDGVLTVTVAKEEVKKPEVKAIDISGA* | |||
Physicochemical properties | |||
Number of amino acids: | 174 | ||
Molecular weight: | 19,577.845 | ||
Theoretical pI: | 5.396 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
Instability index: | 55.261 | ||
aromaticity | 0.069 | ||
GRAVY | -0.641 | ||
Secondary Structure Fraction | |||
Helix | 0.270 | ||
turn | 0.247 | ||
sheet | 0.259 |