| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146580.1 | 5prime_partial | 174 | 2-526(+) |
Amino Acid sequence : | |||
| PEKMSIVPSGFGFGLGSRPSNILDPLSLDLWDPFDRCPFLHDFLSTSTPSLNFPGETSALANTRVDWKETPRAHVFRVDLPGIKKEEVKVEVEEGRVLQISGERSKEKDEEEGEESRWHR VERSSGKFTRRFRLPENAKLDQVKATMEDGVLTVTVAKEEVKKPEVKAIDISGA* | |||
Physicochemical properties | |||
| Number of amino acids: | 174 | ||
| Molecular weight: | 19,577.845 | ||
| Theoretical pI: | 5.396 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
| Instability index: | 55.261 | ||
| aromaticity | 0.069 | ||
| GRAVY | -0.641 | ||
Secondary Structure Fraction | |||
| Helix | 0.270 | ||
| turn | 0.247 | ||
| sheet | 0.259 | ||