Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146593.1 | 5prime_partial | 173 | 1-522(+) |
Amino Acid sequence : | |||
SGSPGLQDSARADPKKPLLMAIKAQIYDVTQSRMFYGPGGPYALFAGKDASRALAKMSFEDKDLTGDISGLGPFELEALQDWEYKFMSKYTKVGTIKKSVPETEGPTEAEVTEASTLTTE RGLAEGQAEHSAESKEDNTPAKEEDTPTGDGDAEAKYVAELKEVVEEDKKTEE* | |||
Physicochemical properties | |||
Number of amino acids: | 173 | ||
Molecular weight: | 18,747.458 | ||
Theoretical pI: | 4.544 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14440 | ||
Instability index: | 47.491 | ||
aromaticity | 0.069 | ||
GRAVY | -0.785 | ||
Secondary Structure Fraction | |||
Helix | 0.202 | ||
turn | 0.220 | ||
sheet | 0.335 |