| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146597.1 | 3prime_partial | 198 | 35-628(+) |
Amino Acid sequence : | |||
| MESIPVIARKLEGKVAVITGGASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVNKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVN LIGPFLGTKHAARVMIPARCRGSIISMSSIASVNAGITPHGYACSKHGVVGLTKCAAFELGTHGIRVNCVSPQLLSTP | |||
Physicochemical properties | |||
| Number of amino acids: | 198 | ||
| Molecular weight: | 20,721.706 | ||
| Theoretical pI: | 8.171 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4845 | ||
| Instability index: | 28.828 | ||
| aromaticity | 0.045 | ||
| GRAVY | 0.221 | ||
Secondary Structure Fraction | |||
| Helix | 0.298 | ||
| turn | 0.268 | ||
| sheet | 0.232 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146597.1 | 3prime_partial | 198 | 35-628(+) |
Amino Acid sequence : | |||
| MESIPVIARKLEGKVAVITGGASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVNKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVN LIGPFLGTKHAARVMIPARCRGSIISMSSIASVNAGITPHGYACSKHGVVGLTKCAAFELGTHGIRVNCVSPQLLSTP | |||
Physicochemical properties | |||
| Number of amino acids: | 198 | ||
| Molecular weight: | 20,721.706 | ||
| Theoretical pI: | 8.171 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4845 | ||
| Instability index: | 28.828 | ||
| aromaticity | 0.045 | ||
| GRAVY | 0.221 | ||
Secondary Structure Fraction | |||
| Helix | 0.298 | ||
| turn | 0.268 | ||
| sheet | 0.232 | ||