| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146622.1 | 5prime_partial | 132 | 2-400(+) |
Amino Acid sequence : | |||
| LLLEAYDKDFDFVRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMEHATEALIQLIK DHGRWVDPSAEE* | |||
Physicochemical properties | |||
| Number of amino acids: | 132 | ||
| Molecular weight: | 14,524.439 | ||
| Theoretical pI: | 5.188 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11710 | ||
| Instability index: | 34.720 | ||
| aromaticity | 0.076 | ||
| GRAVY | -0.131 | ||
Secondary Structure Fraction | |||
| Helix | 0.295 | ||
| turn | 0.212 | ||
| sheet | 0.273 | ||