Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146622.1 | 5prime_partial | 132 | 2-400(+) |
Amino Acid sequence : | |||
LLLEAYDKDFDFVRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMEHATEALIQLIK DHGRWVDPSAEE* | |||
Physicochemical properties | |||
Number of amino acids: | 132 | ||
Molecular weight: | 14,524.439 | ||
Theoretical pI: | 5.188 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11710 | ||
Instability index: | 34.720 | ||
aromaticity | 0.076 | ||
GRAVY | -0.131 | ||
Secondary Structure Fraction | |||
Helix | 0.295 | ||
turn | 0.212 | ||
sheet | 0.273 |