| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146624.1 | internal | 176 | 2-529(+) |
Amino Acid sequence : | |||
| QSLLPSYLYTSSFTSSKNLGLERLMNEKRNPSPNATGALPSNGSVMIGAPNEKRKIELYSPMFYAACTVGGIASCGLTHTLVTPLDLVKCNMQIDPAKYKSISSGFGVLLKEQGVKGFFR GWVPTLLGYSAQGACKFGFYEFFKKYYSDIAGPEYAVKYKTLIYLAGSASAEVIAD | |||
Physicochemical properties | |||
| Number of amino acids: | 176 | ||
| Molecular weight: | 19,103.810 | ||
| Theoretical pI: | 9.086 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23380 23630 | ||
| Instability index: | 44.339 | ||
| aromaticity | 0.125 | ||
| GRAVY | -0.024 | ||
Secondary Structure Fraction | |||
| Helix | 0.324 | ||
| turn | 0.295 | ||
| sheet | 0.256 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146624.1 | internal | 176 | 2-529(+) |
Amino Acid sequence : | |||
| QSLLPSYLYTSSFTSSKNLGLERLMNEKRNPSPNATGALPSNGSVMIGAPNEKRKIELYSPMFYAACTVGGIASCGLTHTLVTPLDLVKCNMQIDPAKYKSISSGFGVLLKEQGVKGFFR GWVPTLLGYSAQGACKFGFYEFFKKYYSDIAGPEYAVKYKTLIYLAGSASAEVIAD | |||
Physicochemical properties | |||
| Number of amino acids: | 176 | ||
| Molecular weight: | 19,103.810 | ||
| Theoretical pI: | 9.086 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23380 23630 | ||
| Instability index: | 44.339 | ||
| aromaticity | 0.125 | ||
| GRAVY | -0.024 | ||
Secondary Structure Fraction | |||
| Helix | 0.324 | ||
| turn | 0.295 | ||
| sheet | 0.256 | ||