Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146638.1 | 5prime_partial | 144 | 2-436(+) |
Amino Acid sequence : | |||
HETVIRIAMNNAPGASGPVYQTEKFTKVDDERRVKVAVVTQGGMLDLGFLSFLNIFEIIERTDDSCTIRSSLEYEVDDEHADAAKLASTASLAMIAKAIVKHLLENEKEGCMKVMSSKLC FDYKLWFKRLFQSKARGVKISDAM* | |||
Physicochemical properties | |||
Number of amino acids: | 144 | ||
Molecular weight: | 16,124.458 | ||
Theoretical pI: | 6.354 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
Instability index: | 38.041 | ||
aromaticity | 0.076 | ||
GRAVY | -0.127 | ||
Secondary Structure Fraction | |||
Helix | 0.299 | ||
turn | 0.167 | ||
sheet | 0.299 |