| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146649.1 | internal | 113 | 2-340(+) |
Amino Acid sequence : | |||
| VMIPARCRGSIISMSSIASVNAGITPHGYACSKHGVVGLTKCAAFELGTHGIRVNCVSPQLLSTPLTTGFYNRTEEEVEAVTASVANLKGIIFRAEDVANAVLYLASDESAYV | |||
Physicochemical properties | |||
| Number of amino acids: | 113 | ||
| Molecular weight: | 11,860.460 | ||
| Theoretical pI: | 6.302 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6210 | ||
| Instability index: | 30.359 | ||
| aromaticity | 0.062 | ||
| GRAVY | 0.339 | ||
Secondary Structure Fraction | |||
| Helix | 0.310 | ||
| turn | 0.257 | ||
| sheet | 0.274 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146649.1 | internal | 113 | 2-340(+) |
Amino Acid sequence : | |||
| VMIPARCRGSIISMSSIASVNAGITPHGYACSKHGVVGLTKCAAFELGTHGIRVNCVSPQLLSTPLTTGFYNRTEEEVEAVTASVANLKGIIFRAEDVANAVLYLASDESAYV | |||
Physicochemical properties | |||
| Number of amino acids: | 113 | ||
| Molecular weight: | 11,860.460 | ||
| Theoretical pI: | 6.302 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6210 | ||
| Instability index: | 30.359 | ||
| aromaticity | 0.062 | ||
| GRAVY | 0.339 | ||
Secondary Structure Fraction | |||
| Helix | 0.310 | ||
| turn | 0.257 | ||
| sheet | 0.274 | ||