| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146662.1 | 5prime_partial | 182 | 2-550(+) |
Amino Acid sequence : | |||
| EMGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDA VLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKS* | |||
Physicochemical properties | |||
| Number of amino acids: | 182 | ||
| Molecular weight: | 10,994.710 | ||
| Theoretical pI: | 9.615 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4720 | ||
| Instability index: | 28.222 | ||
| aromaticity | 0.080 | ||
| GRAVY | 0.127 | ||
Secondary Structure Fraction | |||
| Helix | 0.320 | ||
| turn | 0.270 | ||
| sheet | 0.240 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146662.1 | complete | 108 | 81-407(+) |
Amino Acid sequence : | |||
| MLPVRPPSSTSSSSVRSSPRYPPSDLMWRLWNTRTLVSLFGMWGVRIRSDLCGGTTFRTPKVLSLLLTAMTEIVLWRPGMSSTGCSMRMSCGMLFCLCLLTNRICQMQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 108 | ||
| Molecular weight: | 10,994.710 | ||
| Theoretical pI: | 9.615 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4720 | ||
| Instability index: | 28.222 | ||
| aromaticity | 0.080 | ||
| GRAVY | 0.127 | ||
Secondary Structure Fraction | |||
| Helix | 0.320 | ||
| turn | 0.270 | ||
| sheet | 0.240 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146662.1 | complete | 100 | 408-710(+) |
Amino Acid sequence : | |||
| MLLKSQISLVSTPCVSDTGTSRAPVPHLVRGCTKGLIGFPTTSLARAEAKVVRGTTRQSLERYILITPLNEYNAFGIFRTNLSSLFLLHGEYSMPRSFCC* | |||
Physicochemical properties | |||
| Number of amino acids: | 100 | ||
| Molecular weight: | 10,994.710 | ||
| Theoretical pI: | 9.615 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4720 | ||
| Instability index: | 28.222 | ||
| aromaticity | 0.080 | ||
| GRAVY | 0.127 | ||
Secondary Structure Fraction | |||
| Helix | 0.320 | ||
| turn | 0.270 | ||
| sheet | 0.240 | ||