Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146662.1 | 5prime_partial | 182 | 2-550(+) |
Amino Acid sequence : | |||
EMGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDA VLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKS* | |||
Physicochemical properties | |||
Number of amino acids: | 182 | ||
Molecular weight: | 10,994.710 | ||
Theoretical pI: | 9.615 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4720 | ||
Instability index: | 28.222 | ||
aromaticity | 0.080 | ||
GRAVY | 0.127 | ||
Secondary Structure Fraction | |||
Helix | 0.320 | ||
turn | 0.270 | ||
sheet | 0.240 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146662.1 | complete | 108 | 81-407(+) |
Amino Acid sequence : | |||
MLPVRPPSSTSSSSVRSSPRYPPSDLMWRLWNTRTLVSLFGMWGVRIRSDLCGGTTFRTPKVLSLLLTAMTEIVLWRPGMSSTGCSMRMSCGMLFCLCLLTNRICQMQ* | |||
Physicochemical properties | |||
Number of amino acids: | 108 | ||
Molecular weight: | 10,994.710 | ||
Theoretical pI: | 9.615 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4720 | ||
Instability index: | 28.222 | ||
aromaticity | 0.080 | ||
GRAVY | 0.127 | ||
Secondary Structure Fraction | |||
Helix | 0.320 | ||
turn | 0.270 | ||
sheet | 0.240 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146662.1 | complete | 100 | 408-710(+) |
Amino Acid sequence : | |||
MLLKSQISLVSTPCVSDTGTSRAPVPHLVRGCTKGLIGFPTTSLARAEAKVVRGTTRQSLERYILITPLNEYNAFGIFRTNLSSLFLLHGEYSMPRSFCC* | |||
Physicochemical properties | |||
Number of amino acids: | 100 | ||
Molecular weight: | 10,994.710 | ||
Theoretical pI: | 9.615 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4720 | ||
Instability index: | 28.222 | ||
aromaticity | 0.080 | ||
GRAVY | 0.127 | ||
Secondary Structure Fraction | |||
Helix | 0.320 | ||
turn | 0.270 | ||
sheet | 0.240 |