Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146688.1 | complete | 105 | 24-341(+) |
Amino Acid sequence : | |||
MGGRLSYIFVSMLLLSASLCLAQQEEDPENKRCKAALNQGAPRCFDDLYENETLPTGVVCCKNYLDMDSTSPTCWDRLFEDPSSAKNLEDALTKCKSIIKTSALE* | |||
Physicochemical properties | |||
Number of amino acids: | 105 | ||
Molecular weight: | 11,662.188 | ||
Theoretical pI: | 4.682 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10345 | ||
Instability index: | 43.694 | ||
aromaticity | 0.067 | ||
GRAVY | -0.291 | ||
Secondary Structure Fraction | |||
Helix | 0.257 | ||
turn | 0.229 | ||
sheet | 0.314 |