Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146697.1 | 5prime_partial | 198 | 2-598(+) |
Amino Acid sequence : | |||
WRREMAFMICFPMMIMMLFLFPLISFAQPISVHTYPAALKSSSIIPQPQDNQQVVGPCLYTVQIHTSCLSPPKTNDYIAIKFGDSFYHRVYKQIKAPRRDFQFRNCSSDTFNIQGPCGTA DSICYLYLGRYGNDGWRPDTVTVRKLNSRNSRSSMFKFDSVLPNNIWCGFDRCRGEISSPPSNNDATYDYRDGYHCTA* | |||
Physicochemical properties | |||
Number of amino acids: | 198 | ||
Molecular weight: | 16,497.034 | ||
Theoretical pI: | 9.412 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 26930 | ||
Instability index: | 31.844 | ||
aromaticity | 0.078 | ||
GRAVY | 0.473 | ||
Secondary Structure Fraction | |||
Helix | 0.399 | ||
turn | 0.216 | ||
sheet | 0.255 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146697.1 | complete | 153 | 586-125(-) |
Amino Acid sequence : | |||
MITVTIIVSRIVVGGRGGDLSSAAVETAPYVIRKNAVKFEHAAATVATVELPYRYSIGSPAVVPVSAQIQVANTISGTARTLNVECVGGAVAELEIPSRRLYLLIHPVIKTVAKLDGYVV VGFWWRQAASVYLHRVEARPYDLLIILGLWNNG* | |||
Physicochemical properties | |||
Number of amino acids: | 153 | ||
Molecular weight: | 16,497.034 | ||
Theoretical pI: | 9.412 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 26930 | ||
Instability index: | 31.844 | ||
aromaticity | 0.078 | ||
GRAVY | 0.473 | ||
Secondary Structure Fraction | |||
Helix | 0.399 | ||
turn | 0.216 | ||
sheet | 0.255 |