| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146707.1 | internal | 208 | 1-624(+) |
Amino Acid sequence : | |||
| GTKGSLKRLDMEYVDIVYCHRPDALTPIEETVRAMNYVIDNGWAFYWGTSEWSAQQITAAWAAAERLDLVGPVVEQPEYNLLSRHKVEVEYLPLYSAHGLGLTTWSPLASGVLTGKYNQG NIPPDSRFALDNYKNLASRSLVDDTLKKVNRLKPIADELGVPLSQLAIAWCASNPNVASVITGATKESQIKENMKAIDVIPKLTPDVL | |||
Physicochemical properties | |||
| Number of amino acids: | 208 | ||
| Molecular weight: | 22,984.932 | ||
| Theoretical pI: | 5.422 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 46410 46535 | ||
| Instability index: | 25.358 | ||
| aromaticity | 0.082 | ||
| GRAVY | -0.181 | ||
Secondary Structure Fraction | |||
| Helix | 0.327 | ||
| turn | 0.240 | ||
| sheet | 0.279 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146707.1 | internal | 208 | 1-624(+) |
Amino Acid sequence : | |||
| GTKGSLKRLDMEYVDIVYCHRPDALTPIEETVRAMNYVIDNGWAFYWGTSEWSAQQITAAWAAAERLDLVGPVVEQPEYNLLSRHKVEVEYLPLYSAHGLGLTTWSPLASGVLTGKYNQG NIPPDSRFALDNYKNLASRSLVDDTLKKVNRLKPIADELGVPLSQLAIAWCASNPNVASVITGATKESQIKENMKAIDVIPKLTPDVL | |||
Physicochemical properties | |||
| Number of amino acids: | 208 | ||
| Molecular weight: | 22,984.932 | ||
| Theoretical pI: | 5.422 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 46410 46535 | ||
| Instability index: | 25.358 | ||
| aromaticity | 0.082 | ||
| GRAVY | -0.181 | ||
Secondary Structure Fraction | |||
| Helix | 0.327 | ||
| turn | 0.240 | ||
| sheet | 0.279 | ||