| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146711.1 | internal | 109 | 2-328(+) |
Amino Acid sequence : | |||
| PLIGWMHGAQMVAFNMQGYGRSLWLMHGFYRANGGCGYVKKPDFLQHTGPHGEVFDPKASLPAKKTLKVKVYMGDGWRMDFKQTHFDAYSPPDFYTRVGIAGVPADSIM | |||
Physicochemical properties | |||
| Number of amino acids: | 109 | ||
| Molecular weight: | 12,228.004 | ||
| Theoretical pI: | 9.319 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25440 | ||
| Instability index: | 40.486 | ||
| aromaticity | 0.147 | ||
| GRAVY | -0.308 | ||
Secondary Structure Fraction | |||
| Helix | 0.294 | ||
| turn | 0.257 | ||
| sheet | 0.202 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146711.1 | internal | 109 | 2-328(+) |
Amino Acid sequence : | |||
| PLIGWMHGAQMVAFNMQGYGRSLWLMHGFYRANGGCGYVKKPDFLQHTGPHGEVFDPKASLPAKKTLKVKVYMGDGWRMDFKQTHFDAYSPPDFYTRVGIAGVPADSIM | |||
Physicochemical properties | |||
| Number of amino acids: | 109 | ||
| Molecular weight: | 12,228.004 | ||
| Theoretical pI: | 9.319 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25440 | ||
| Instability index: | 40.486 | ||
| aromaticity | 0.147 | ||
| GRAVY | -0.308 | ||
Secondary Structure Fraction | |||
| Helix | 0.294 | ||
| turn | 0.257 | ||
| sheet | 0.202 | ||