| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146718.1 | internal | 153 | 460-2(-) |
Amino Acid sequence : | |||
| LVVPLTTLASALASDVVGKPIKPFVQPLTRCGTGALDVPVSLTQGVETKLICDFSSIHCIWQILFVSKHKQNSIPQLILIEHPVELIPGLHNTISVIAVNNKDKTLGVLKVVPPQRSDLI LTPHIPNSETNVLVFHSLHIKSDGGYRGDDLTE | |||
Physicochemical properties | |||
| Number of amino acids: | 153 | ||
| Molecular weight: | 16,365.152 | ||
| Theoretical pI: | 4.994 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 27960 | ||
| Instability index: | 37.054 | ||
| aromaticity | 0.091 | ||
| GRAVY | -0.376 | ||
Secondary Structure Fraction | |||
| Helix | 0.336 | ||
| turn | 0.210 | ||
| sheet | 0.245 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146718.1 | 5prime_partial | 143 | 2-433(+) |
Amino Acid sequence : | |||
| LGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQST CATSGEGLYEGLDWLSNNIASKS* | |||
Physicochemical properties | |||
| Number of amino acids: | 143 | ||
| Molecular weight: | 16,365.152 | ||
| Theoretical pI: | 4.994 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 27960 | ||
| Instability index: | 37.054 | ||
| aromaticity | 0.091 | ||
| GRAVY | -0.376 | ||
Secondary Structure Fraction | |||
| Helix | 0.336 | ||
| turn | 0.210 | ||
| sheet | 0.245 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146718.1 | internal | 153 | 460-2(-) |
Amino Acid sequence : | |||
| LVVPLTTLASALASDVVGKPIKPFVQPLTRCGTGALDVPVSLTQGVETKLICDFSSIHCIWQILFVSKHKQNSIPQLILIEHPVELIPGLHNTISVIAVNNKDKTLGVLKVVPPQRSDLI LTPHIPNSETNVLVFHSLHIKSDGGYRGDDLTE | |||
Physicochemical properties | |||
| Number of amino acids: | 153 | ||
| Molecular weight: | 16,365.152 | ||
| Theoretical pI: | 4.994 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 27960 | ||
| Instability index: | 37.054 | ||
| aromaticity | 0.091 | ||
| GRAVY | -0.376 | ||
Secondary Structure Fraction | |||
| Helix | 0.336 | ||
| turn | 0.210 | ||
| sheet | 0.245 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146718.1 | 5prime_partial | 143 | 2-433(+) |
Amino Acid sequence : | |||
| LGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQST CATSGEGLYEGLDWLSNNIASKS* | |||
Physicochemical properties | |||
| Number of amino acids: | 143 | ||
| Molecular weight: | 16,365.152 | ||
| Theoretical pI: | 4.994 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 27960 | ||
| Instability index: | 37.054 | ||
| aromaticity | 0.091 | ||
| GRAVY | -0.376 | ||
Secondary Structure Fraction | |||
| Helix | 0.336 | ||
| turn | 0.210 | ||
| sheet | 0.245 | ||