Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146718.1 | internal | 153 | 460-2(-) |
Amino Acid sequence : | |||
LVVPLTTLASALASDVVGKPIKPFVQPLTRCGTGALDVPVSLTQGVETKLICDFSSIHCIWQILFVSKHKQNSIPQLILIEHPVELIPGLHNTISVIAVNNKDKTLGVLKVVPPQRSDLI LTPHIPNSETNVLVFHSLHIKSDGGYRGDDLTE | |||
Physicochemical properties | |||
Number of amino acids: | 153 | ||
Molecular weight: | 16,365.152 | ||
Theoretical pI: | 4.994 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 27960 | ||
Instability index: | 37.054 | ||
aromaticity | 0.091 | ||
GRAVY | -0.376 | ||
Secondary Structure Fraction | |||
Helix | 0.336 | ||
turn | 0.210 | ||
sheet | 0.245 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146718.1 | 5prime_partial | 143 | 2-433(+) |
Amino Acid sequence : | |||
LGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQST CATSGEGLYEGLDWLSNNIASKS* | |||
Physicochemical properties | |||
Number of amino acids: | 143 | ||
Molecular weight: | 16,365.152 | ||
Theoretical pI: | 4.994 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 27960 | ||
Instability index: | 37.054 | ||
aromaticity | 0.091 | ||
GRAVY | -0.376 | ||
Secondary Structure Fraction | |||
Helix | 0.336 | ||
turn | 0.210 | ||
sheet | 0.245 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146718.1 | internal | 153 | 460-2(-) |
Amino Acid sequence : | |||
LVVPLTTLASALASDVVGKPIKPFVQPLTRCGTGALDVPVSLTQGVETKLICDFSSIHCIWQILFVSKHKQNSIPQLILIEHPVELIPGLHNTISVIAVNNKDKTLGVLKVVPPQRSDLI LTPHIPNSETNVLVFHSLHIKSDGGYRGDDLTE | |||
Physicochemical properties | |||
Number of amino acids: | 153 | ||
Molecular weight: | 16,365.152 | ||
Theoretical pI: | 4.994 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 27960 | ||
Instability index: | 37.054 | ||
aromaticity | 0.091 | ||
GRAVY | -0.376 | ||
Secondary Structure Fraction | |||
Helix | 0.336 | ||
turn | 0.210 | ||
sheet | 0.245 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146718.1 | 5prime_partial | 143 | 2-433(+) |
Amino Acid sequence : | |||
LGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQST CATSGEGLYEGLDWLSNNIASKS* | |||
Physicochemical properties | |||
Number of amino acids: | 143 | ||
Molecular weight: | 16,365.152 | ||
Theoretical pI: | 4.994 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 27960 | ||
Instability index: | 37.054 | ||
aromaticity | 0.091 | ||
GRAVY | -0.376 | ||
Secondary Structure Fraction | |||
Helix | 0.336 | ||
turn | 0.210 | ||
sheet | 0.245 |