| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146719.1 | 3prime_partial | 178 | 81-614(+) |
Amino Acid sequence : | |||
| MESIPVIARKLEGKVAVITGGASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVNKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVN LIGPFLGTKHAARVMIPARCRGSIISMSSIASVNAGITPHGYACSKHGVVGLTKCAAF | |||
Physicochemical properties | |||
| Number of amino acids: | 178 | ||
| Molecular weight: | 18,618.304 | ||
| Theoretical pI: | 8.224 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4845 | ||
| Instability index: | 29.515 | ||
| aromaticity | 0.051 | ||
| GRAVY | 0.237 | ||
Secondary Structure Fraction | |||
| Helix | 0.298 | ||
| turn | 0.258 | ||
| sheet | 0.236 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146719.1 | 3prime_partial | 178 | 81-614(+) |
Amino Acid sequence : | |||
| MESIPVIARKLEGKVAVITGGASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVNKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVN LIGPFLGTKHAARVMIPARCRGSIISMSSIASVNAGITPHGYACSKHGVVGLTKCAAF | |||
Physicochemical properties | |||
| Number of amino acids: | 178 | ||
| Molecular weight: | 18,618.304 | ||
| Theoretical pI: | 8.224 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4845 | ||
| Instability index: | 29.515 | ||
| aromaticity | 0.051 | ||
| GRAVY | 0.237 | ||
Secondary Structure Fraction | |||
| Helix | 0.298 | ||
| turn | 0.258 | ||
| sheet | 0.236 | ||