Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146719.1 | 3prime_partial | 178 | 81-614(+) |
Amino Acid sequence : | |||
MESIPVIARKLEGKVAVITGGASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVNKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVN LIGPFLGTKHAARVMIPARCRGSIISMSSIASVNAGITPHGYACSKHGVVGLTKCAAF | |||
Physicochemical properties | |||
Number of amino acids: | 178 | ||
Molecular weight: | 18,618.304 | ||
Theoretical pI: | 8.224 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4845 | ||
Instability index: | 29.515 | ||
aromaticity | 0.051 | ||
GRAVY | 0.237 | ||
Secondary Structure Fraction | |||
Helix | 0.298 | ||
turn | 0.258 | ||
sheet | 0.236 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146719.1 | 3prime_partial | 178 | 81-614(+) |
Amino Acid sequence : | |||
MESIPVIARKLEGKVAVITGGASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVNKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVN LIGPFLGTKHAARVMIPARCRGSIISMSSIASVNAGITPHGYACSKHGVVGLTKCAAF | |||
Physicochemical properties | |||
Number of amino acids: | 178 | ||
Molecular weight: | 18,618.304 | ||
Theoretical pI: | 8.224 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4845 | ||
Instability index: | 29.515 | ||
aromaticity | 0.051 | ||
GRAVY | 0.237 | ||
Secondary Structure Fraction | |||
Helix | 0.298 | ||
turn | 0.258 | ||
sheet | 0.236 |