| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146731.1 | internal | 171 | 3-515(+) |
Amino Acid sequence : | |||
| GVLQLVGTDHCAFNSSQKALGVDDFRKIPNGVNGIEERMHLIWDTMVESGQISITDYVRVTSTECARIFNIYPRKGAILEGSDADLIILNPNASFKISAAAHHSRSDTNVYEGRTGKGKV EVTISGGRIVWQEGRLNVVPGSGRYIEMPPYGHLFDGIDKADAEYIASLRA | |||
Physicochemical properties | |||
| Number of amino acids: | 171 | ||
| Molecular weight: | 18,693.865 | ||
| Theoretical pI: | 5.951 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20065 | ||
| Instability index: | 27.956 | ||
| aromaticity | 0.076 | ||
| GRAVY | -0.222 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.263 | ||
| sheet | 0.211 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146731.1 | internal | 171 | 3-515(+) |
Amino Acid sequence : | |||
| GVLQLVGTDHCAFNSSQKALGVDDFRKIPNGVNGIEERMHLIWDTMVESGQISITDYVRVTSTECARIFNIYPRKGAILEGSDADLIILNPNASFKISAAAHHSRSDTNVYEGRTGKGKV EVTISGGRIVWQEGRLNVVPGSGRYIEMPPYGHLFDGIDKADAEYIASLRA | |||
Physicochemical properties | |||
| Number of amino acids: | 171 | ||
| Molecular weight: | 18,693.865 | ||
| Theoretical pI: | 5.951 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20065 | ||
| Instability index: | 27.956 | ||
| aromaticity | 0.076 | ||
| GRAVY | -0.222 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.263 | ||
| sheet | 0.211 | ||