Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146732.1 | internal | 181 | 3-545(+) |
Amino Acid sequence : | |||
AESDARSDQINREEQQQEKLRLKYLDFVHVAAIQALFFLSRLYDFAKDNSGPLKPGVQSVEGTVKAVVGPVYEKFHGVPFELLTFVDCKVGESIGEIKRHVPLPLKDATNKARSFSSEAQ RAGLVGTATCLARAAYTKAEPTAKVLYQRYAPVAEQYAVSAWRSLNRLPVFPQVAQIVVPT | |||
Physicochemical properties | |||
Number of amino acids: | 181 | ||
Molecular weight: | 13,615.224 | ||
Theoretical pI: | 6.040 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
Instability index: | 22.942 | ||
aromaticity | 0.055 | ||
GRAVY | -0.277 | ||
Secondary Structure Fraction | |||
Helix | 0.297 | ||
turn | 0.297 | ||
sheet | 0.258 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146732.1 | 5prime_partial | 128 | 545-159(-) |
Amino Acid sequence : | |||
SRDDNLGDLGEHREPVQGPPCRDRVLLCHRRVPLVQNLGGWLGLGIGSTGKTGGSADKAGTLGFAGEGPGLVGCILQWKRHVTLNFSDGLPNLTIYEGEKLKGNAVELFVYRAHDGLDSA LDGLDARL* | |||
Physicochemical properties | |||
Number of amino acids: | 128 | ||
Molecular weight: | 13,615.224 | ||
Theoretical pI: | 6.040 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
Instability index: | 22.942 | ||
aromaticity | 0.055 | ||
GRAVY | -0.277 | ||
Secondary Structure Fraction | |||
Helix | 0.297 | ||
turn | 0.297 | ||
sheet | 0.258 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146732.1 | internal | 181 | 3-545(+) |
Amino Acid sequence : | |||
AESDARSDQINREEQQQEKLRLKYLDFVHVAAIQALFFLSRLYDFAKDNSGPLKPGVQSVEGTVKAVVGPVYEKFHGVPFELLTFVDCKVGESIGEIKRHVPLPLKDATNKARSFSSEAQ RAGLVGTATCLARAAYTKAEPTAKVLYQRYAPVAEQYAVSAWRSLNRLPVFPQVAQIVVPT | |||
Physicochemical properties | |||
Number of amino acids: | 181 | ||
Molecular weight: | 13,615.224 | ||
Theoretical pI: | 6.040 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
Instability index: | 22.942 | ||
aromaticity | 0.055 | ||
GRAVY | -0.277 | ||
Secondary Structure Fraction | |||
Helix | 0.297 | ||
turn | 0.297 | ||
sheet | 0.258 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146732.1 | 5prime_partial | 128 | 545-159(-) |
Amino Acid sequence : | |||
SRDDNLGDLGEHREPVQGPPCRDRVLLCHRRVPLVQNLGGWLGLGIGSTGKTGGSADKAGTLGFAGEGPGLVGCILQWKRHVTLNFSDGLPNLTIYEGEKLKGNAVELFVYRAHDGLDSA LDGLDARL* | |||
Physicochemical properties | |||
Number of amino acids: | 128 | ||
Molecular weight: | 13,615.224 | ||
Theoretical pI: | 6.040 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
Instability index: | 22.942 | ||
aromaticity | 0.055 | ||
GRAVY | -0.277 | ||
Secondary Structure Fraction | |||
Helix | 0.297 | ||
turn | 0.297 | ||
sheet | 0.258 |