| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146732.1 | internal | 181 | 3-545(+) |
Amino Acid sequence : | |||
| AESDARSDQINREEQQQEKLRLKYLDFVHVAAIQALFFLSRLYDFAKDNSGPLKPGVQSVEGTVKAVVGPVYEKFHGVPFELLTFVDCKVGESIGEIKRHVPLPLKDATNKARSFSSEAQ RAGLVGTATCLARAAYTKAEPTAKVLYQRYAPVAEQYAVSAWRSLNRLPVFPQVAQIVVPT | |||
Physicochemical properties | |||
| Number of amino acids: | 181 | ||
| Molecular weight: | 13,615.224 | ||
| Theoretical pI: | 6.040 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 22.942 | ||
| aromaticity | 0.055 | ||
| GRAVY | -0.277 | ||
Secondary Structure Fraction | |||
| Helix | 0.297 | ||
| turn | 0.297 | ||
| sheet | 0.258 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146732.1 | 5prime_partial | 128 | 545-159(-) |
Amino Acid sequence : | |||
| SRDDNLGDLGEHREPVQGPPCRDRVLLCHRRVPLVQNLGGWLGLGIGSTGKTGGSADKAGTLGFAGEGPGLVGCILQWKRHVTLNFSDGLPNLTIYEGEKLKGNAVELFVYRAHDGLDSA LDGLDARL* | |||
Physicochemical properties | |||
| Number of amino acids: | 128 | ||
| Molecular weight: | 13,615.224 | ||
| Theoretical pI: | 6.040 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 22.942 | ||
| aromaticity | 0.055 | ||
| GRAVY | -0.277 | ||
Secondary Structure Fraction | |||
| Helix | 0.297 | ||
| turn | 0.297 | ||
| sheet | 0.258 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146732.1 | internal | 181 | 3-545(+) |
Amino Acid sequence : | |||
| AESDARSDQINREEQQQEKLRLKYLDFVHVAAIQALFFLSRLYDFAKDNSGPLKPGVQSVEGTVKAVVGPVYEKFHGVPFELLTFVDCKVGESIGEIKRHVPLPLKDATNKARSFSSEAQ RAGLVGTATCLARAAYTKAEPTAKVLYQRYAPVAEQYAVSAWRSLNRLPVFPQVAQIVVPT | |||
Physicochemical properties | |||
| Number of amino acids: | 181 | ||
| Molecular weight: | 13,615.224 | ||
| Theoretical pI: | 6.040 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 22.942 | ||
| aromaticity | 0.055 | ||
| GRAVY | -0.277 | ||
Secondary Structure Fraction | |||
| Helix | 0.297 | ||
| turn | 0.297 | ||
| sheet | 0.258 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146732.1 | 5prime_partial | 128 | 545-159(-) |
Amino Acid sequence : | |||
| SRDDNLGDLGEHREPVQGPPCRDRVLLCHRRVPLVQNLGGWLGLGIGSTGKTGGSADKAGTLGFAGEGPGLVGCILQWKRHVTLNFSDGLPNLTIYEGEKLKGNAVELFVYRAHDGLDSA LDGLDARL* | |||
Physicochemical properties | |||
| Number of amino acids: | 128 | ||
| Molecular weight: | 13,615.224 | ||
| Theoretical pI: | 6.040 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 22.942 | ||
| aromaticity | 0.055 | ||
| GRAVY | -0.277 | ||
Secondary Structure Fraction | |||
| Helix | 0.297 | ||
| turn | 0.297 | ||
| sheet | 0.258 | ||