| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146737.1 | internal | 154 | 3-464(+) |
Amino Acid sequence : | |||
| CTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVNKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVNLIGPFLGTKHAARVMIPARCRGSIISM SSIASVNAGITPHGYACSKHGVVGLTKCAAFELG | |||
Physicochemical properties | |||
| Number of amino acids: | 154 | ||
| Molecular weight: | 16,252.514 | ||
| Theoretical pI: | 7.797 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4845 | ||
| Instability index: | 30.385 | ||
| aromaticity | 0.058 | ||
| GRAVY | 0.188 | ||
Secondary Structure Fraction | |||
| Helix | 0.299 | ||
| turn | 0.253 | ||
| sheet | 0.234 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146737.1 | internal | 154 | 3-464(+) |
Amino Acid sequence : | |||
| CTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVNKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVNLIGPFLGTKHAARVMIPARCRGSIISM SSIASVNAGITPHGYACSKHGVVGLTKCAAFELG | |||
Physicochemical properties | |||
| Number of amino acids: | 154 | ||
| Molecular weight: | 16,252.514 | ||
| Theoretical pI: | 7.797 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4845 | ||
| Instability index: | 30.385 | ||
| aromaticity | 0.058 | ||
| GRAVY | 0.188 | ||
Secondary Structure Fraction | |||
| Helix | 0.299 | ||
| turn | 0.253 | ||
| sheet | 0.234 | ||