| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146744.1 | 5prime_partial | 121 | 3-368(+) |
Amino Acid sequence : | |||
| PGLEDHPNHKLLESMANPGYGFGGMMCVDMGTEERANRLMNHLQNSTEFGLMAVSLGYYETLMSCSGSSTSSELSTQDKELAGISPGLVRMSVGYSGTIDQRWGQFEKAISRMQVDVHAK N* | |||
Physicochemical properties | |||
| Number of amino acids: | 121 | ||
| Molecular weight: | 13,208.733 | ||
| Theoretical pI: | 5.231 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 39.179 | ||
| aromaticity | 0.066 | ||
| GRAVY | -0.414 | ||
Secondary Structure Fraction | |||
| Helix | 0.231 | ||
| turn | 0.314 | ||
| sheet | 0.289 | ||