Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146744.1 | 5prime_partial | 121 | 3-368(+) |
Amino Acid sequence : | |||
PGLEDHPNHKLLESMANPGYGFGGMMCVDMGTEERANRLMNHLQNSTEFGLMAVSLGYYETLMSCSGSSTSSELSTQDKELAGISPGLVRMSVGYSGTIDQRWGQFEKAISRMQVDVHAK N* | |||
Physicochemical properties | |||
Number of amino acids: | 121 | ||
Molecular weight: | 13,208.733 | ||
Theoretical pI: | 5.231 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
Instability index: | 39.179 | ||
aromaticity | 0.066 | ||
GRAVY | -0.414 | ||
Secondary Structure Fraction | |||
Helix | 0.231 | ||
turn | 0.314 | ||
sheet | 0.289 |