Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146748.1 | 5prime_partial | 177 | 1-534(+) |
Amino Acid sequence : | |||
KKGELRKRRIFSPQKMAPIAVGDSIPDGTLAWFDENDELKQVSIHSLAAGKKVILFGVPGAFTPTCSMQHVPGFITSADELKSKGVDEILLVSVNDPFVMKAWAKTYPDNKHVKFLADGS GTYTHALGLELDLSEKGLGTRSRRFALLADDLKVKVANIEEGGAFTISGADEILKAL* | |||
Physicochemical properties | |||
Number of amino acids: | 177 | ||
Molecular weight: | 10,709.298 | ||
Theoretical pI: | 9.415 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
Instability index: | 56.490 | ||
aromaticity | 0.101 | ||
GRAVY | 0.193 | ||
Secondary Structure Fraction | |||
Helix | 0.303 | ||
turn | 0.323 | ||
sheet | 0.212 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146748.1 | 3prime_partial | 99 | 299-3(-) |
Amino Acid sequence : | |||
MTKGSFTLTRRISSTPLDFNSSALVINPGTCCILQVGVKAPGTPKRMTFLPAAREWIETCFSSSFSSNHARVPSGIESPTAIGAIFWGEKILLFLNSPF | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 10,709.298 | ||
Theoretical pI: | 9.415 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
Instability index: | 56.490 | ||
aromaticity | 0.101 | ||
GRAVY | 0.193 | ||
Secondary Structure Fraction | |||
Helix | 0.303 | ||
turn | 0.323 | ||
sheet | 0.212 |