| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146752.1 | 3prime_partial | 218 | 25-678(+) |
Amino Acid sequence : | |||
| MQLNKEAASLDWTKSQSHTLSGRKISDHYEEELISGASSSYTGQKLGGGSKSSSNARASSVAAAYNRFINTSPEKAYPSDEDQLSNASSGTEPYDGDLRGVQENIHAELDPNDVPMIEDD ASSVEIMMDHMGSPYGASINVEDEEPKMGAGKAFVSIVEPDPDNSELGEAIEAFSEPDPDDSMLGNADLSRSEEPDPDDLASAQEKGGKISEESDPDD | |||
Physicochemical properties | |||
| Number of amino acids: | 218 | ||
| Molecular weight: | 23,238.499 | ||
| Theoretical pI: | 4.084 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14440 | ||
| Instability index: | 55.374 | ||
| aromaticity | 0.046 | ||
| GRAVY | -0.864 | ||
Secondary Structure Fraction | |||
| Helix | 0.179 | ||
| turn | 0.339 | ||
| sheet | 0.289 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146752.1 | 3prime_partial | 218 | 25-678(+) |
Amino Acid sequence : | |||
| MQLNKEAASLDWTKSQSHTLSGRKISDHYEEELISGASSSYTGQKLGGGSKSSSNARASSVAAAYNRFINTSPEKAYPSDEDQLSNASSGTEPYDGDLRGVQENIHAELDPNDVPMIEDD ASSVEIMMDHMGSPYGASINVEDEEPKMGAGKAFVSIVEPDPDNSELGEAIEAFSEPDPDDSMLGNADLSRSEEPDPDDLASAQEKGGKISEESDPDD | |||
Physicochemical properties | |||
| Number of amino acids: | 218 | ||
| Molecular weight: | 23,238.499 | ||
| Theoretical pI: | 4.084 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14440 | ||
| Instability index: | 55.374 | ||
| aromaticity | 0.046 | ||
| GRAVY | -0.864 | ||
Secondary Structure Fraction | |||
| Helix | 0.179 | ||
| turn | 0.339 | ||
| sheet | 0.289 | ||