Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146772.1 | 5prime_partial | 142 | 3-431(+) |
Amino Acid sequence : | |||
HEVTSGGFMVAFAGRKYAARSLPAFVSNSTYTVTSFTLVLEFQKGTLQNLYWKRDACASCSGKTNFVCLNNLECAIKTSSCKGQQGGSVDCSVGIQLAFSGTDKNDAVLNSWYEVSKLRQ YSLYGLYSDLKSSLTDQFTDIF* | |||
Physicochemical properties | |||
Number of amino acids: | 142 | ||
Molecular weight: | 14,302.613 | ||
Theoretical pI: | 10.206 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33000 33125 | ||
Instability index: | 38.727 | ||
aromaticity | 0.094 | ||
GRAVY | 0.309 | ||
Secondary Structure Fraction | |||
Helix | 0.344 | ||
turn | 0.234 | ||
sheet | 0.258 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146772.1 | complete | 128 | 166-552(+) |
Amino Acid sequence : | |||
MLVLRVPGRQTSFALTIWSVPLKLPAAKASRVARWTAASEFSWHSLVPTRTMLFSTHGTKCLSSVSTLSMDCTPTSRVLSQTNSLTSSNIAHLVWTCLVIFTWSFPHTFPLLLLEDVKNL IMTWASKH* | |||
Physicochemical properties | |||
Number of amino acids: | 128 | ||
Molecular weight: | 14,302.613 | ||
Theoretical pI: | 10.206 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33000 33125 | ||
Instability index: | 38.727 | ||
aromaticity | 0.094 | ||
GRAVY | 0.309 | ||
Secondary Structure Fraction | |||
Helix | 0.344 | ||
turn | 0.234 | ||
sheet | 0.258 |