| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146773.1 | internal | 237 | 1-711(+) |
Amino Acid sequence : | |||
| SPGLQEFGTRVHGIDVFDPKFNIVSPGADMSIYFPYYEEHRRLTALHSEIEELLYNPIDNSEHKGFLKDRIKPIIFSMARLDRVKNITGLVELYGRNPRLKELVNLVVVAGDHVKESKDH EEIEEKKKMYRLINEYELEGHIRWISAQMNRVRNGELYRCIADTKGAFVQPALYEAFGLTVIEAMTCGLPMFATAYGGPAEIIVDGVSGYHIDPYQGDKAAELLVDFFDKCKDDPTH | |||
Physicochemical properties | |||
| Number of amino acids: | 237 | ||
| Molecular weight: | 11,115.511 | ||
| Theoretical pI: | 8.819 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 56.419 | ||
| aromaticity | 0.051 | ||
| GRAVY | -0.140 | ||
Secondary Structure Fraction | |||
| Helix | 0.323 | ||
| turn | 0.212 | ||
| sheet | 0.192 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146773.1 | 5prime_partial | 99 | 711-412(-) |
Amino Acid sequence : | |||
| VGRVILALIEEIHQQFSSLVALIRVDVVTRDTIHYDLRGTTISGRKHRQTTCHGFNNSEPKSFIKRRLNESSLCISNAAIELTVANSVHLSRDPTDVTF* | |||
Physicochemical properties | |||
| Number of amino acids: | 99 | ||
| Molecular weight: | 11,115.511 | ||
| Theoretical pI: | 8.819 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 56.419 | ||
| aromaticity | 0.051 | ||
| GRAVY | -0.140 | ||
Secondary Structure Fraction | |||
| Helix | 0.323 | ||
| turn | 0.212 | ||
| sheet | 0.192 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146773.1 | internal | 237 | 1-711(+) |
Amino Acid sequence : | |||
| SPGLQEFGTRVHGIDVFDPKFNIVSPGADMSIYFPYYEEHRRLTALHSEIEELLYNPIDNSEHKGFLKDRIKPIIFSMARLDRVKNITGLVELYGRNPRLKELVNLVVVAGDHVKESKDH EEIEEKKKMYRLINEYELEGHIRWISAQMNRVRNGELYRCIADTKGAFVQPALYEAFGLTVIEAMTCGLPMFATAYGGPAEIIVDGVSGYHIDPYQGDKAAELLVDFFDKCKDDPTH | |||
Physicochemical properties | |||
| Number of amino acids: | 237 | ||
| Molecular weight: | 11,115.511 | ||
| Theoretical pI: | 8.819 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 56.419 | ||
| aromaticity | 0.051 | ||
| GRAVY | -0.140 | ||
Secondary Structure Fraction | |||
| Helix | 0.323 | ||
| turn | 0.212 | ||
| sheet | 0.192 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146773.1 | 5prime_partial | 99 | 711-412(-) |
Amino Acid sequence : | |||
| VGRVILALIEEIHQQFSSLVALIRVDVVTRDTIHYDLRGTTISGRKHRQTTCHGFNNSEPKSFIKRRLNESSLCISNAAIELTVANSVHLSRDPTDVTF* | |||
Physicochemical properties | |||
| Number of amino acids: | 99 | ||
| Molecular weight: | 11,115.511 | ||
| Theoretical pI: | 8.819 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 56.419 | ||
| aromaticity | 0.051 | ||
| GRAVY | -0.140 | ||
Secondary Structure Fraction | |||
| Helix | 0.323 | ||
| turn | 0.212 | ||
| sheet | 0.192 | ||