Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146773.1 | internal | 237 | 1-711(+) |
Amino Acid sequence : | |||
SPGLQEFGTRVHGIDVFDPKFNIVSPGADMSIYFPYYEEHRRLTALHSEIEELLYNPIDNSEHKGFLKDRIKPIIFSMARLDRVKNITGLVELYGRNPRLKELVNLVVVAGDHVKESKDH EEIEEKKKMYRLINEYELEGHIRWISAQMNRVRNGELYRCIADTKGAFVQPALYEAFGLTVIEAMTCGLPMFATAYGGPAEIIVDGVSGYHIDPYQGDKAAELLVDFFDKCKDDPTH | |||
Physicochemical properties | |||
Number of amino acids: | 237 | ||
Molecular weight: | 11,115.511 | ||
Theoretical pI: | 8.819 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 56.419 | ||
aromaticity | 0.051 | ||
GRAVY | -0.140 | ||
Secondary Structure Fraction | |||
Helix | 0.323 | ||
turn | 0.212 | ||
sheet | 0.192 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146773.1 | 5prime_partial | 99 | 711-412(-) |
Amino Acid sequence : | |||
VGRVILALIEEIHQQFSSLVALIRVDVVTRDTIHYDLRGTTISGRKHRQTTCHGFNNSEPKSFIKRRLNESSLCISNAAIELTVANSVHLSRDPTDVTF* | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 11,115.511 | ||
Theoretical pI: | 8.819 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 56.419 | ||
aromaticity | 0.051 | ||
GRAVY | -0.140 | ||
Secondary Structure Fraction | |||
Helix | 0.323 | ||
turn | 0.212 | ||
sheet | 0.192 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146773.1 | internal | 237 | 1-711(+) |
Amino Acid sequence : | |||
SPGLQEFGTRVHGIDVFDPKFNIVSPGADMSIYFPYYEEHRRLTALHSEIEELLYNPIDNSEHKGFLKDRIKPIIFSMARLDRVKNITGLVELYGRNPRLKELVNLVVVAGDHVKESKDH EEIEEKKKMYRLINEYELEGHIRWISAQMNRVRNGELYRCIADTKGAFVQPALYEAFGLTVIEAMTCGLPMFATAYGGPAEIIVDGVSGYHIDPYQGDKAAELLVDFFDKCKDDPTH | |||
Physicochemical properties | |||
Number of amino acids: | 237 | ||
Molecular weight: | 11,115.511 | ||
Theoretical pI: | 8.819 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 56.419 | ||
aromaticity | 0.051 | ||
GRAVY | -0.140 | ||
Secondary Structure Fraction | |||
Helix | 0.323 | ||
turn | 0.212 | ||
sheet | 0.192 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146773.1 | 5prime_partial | 99 | 711-412(-) |
Amino Acid sequence : | |||
VGRVILALIEEIHQQFSSLVALIRVDVVTRDTIHYDLRGTTISGRKHRQTTCHGFNNSEPKSFIKRRLNESSLCISNAAIELTVANSVHLSRDPTDVTF* | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 11,115.511 | ||
Theoretical pI: | 8.819 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 56.419 | ||
aromaticity | 0.051 | ||
GRAVY | -0.140 | ||
Secondary Structure Fraction | |||
Helix | 0.323 | ||
turn | 0.212 | ||
sheet | 0.192 |