| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146779.1 | internal | 179 | 3-539(+) |
Amino Acid sequence : | |||
| AAVIFLLFCLVVTLIVATEVPLAKVSGKGEQEQKVGFLDVFRSIRNLPPGMPSVLLITCLTWLSWFPFILYNTDWMGREVFHGDPKGSVAQIDAYDRGVREGAFGLLLNSIILGIGAFLI EPMCRKLTARVVWVVSNFMVSLVLAAMVILSFWSNHLYDGISTGPDSRVKAIALALFAA | |||
Physicochemical properties | |||
| Number of amino acids: | 179 | ||
| Molecular weight: | 11,770.016 | ||
| Theoretical pI: | 7.752 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18700 | ||
| Instability index: | 52.555 | ||
| aromaticity | 0.090 | ||
| GRAVY | -1.013 | ||
Secondary Structure Fraction | |||
| Helix | 0.230 | ||
| turn | 0.250 | ||
| sheet | 0.150 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146779.1 | complete | 100 | 470-168(-) |
Amino Acid sequence : | |||
| MIGPKTQYYHGSQDQRHHEVAYHPHYSCSEFSAHWLDQKGPNSENNRIQQQTKCTLSNTTIICINLCYRSLWIPMEDFTAHPIRVIEDKRKPRQPSETSN* | |||
Physicochemical properties | |||
| Number of amino acids: | 100 | ||
| Molecular weight: | 11,770.016 | ||
| Theoretical pI: | 7.752 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18700 | ||
| Instability index: | 52.555 | ||
| aromaticity | 0.090 | ||
| GRAVY | -1.013 | ||
Secondary Structure Fraction | |||
| Helix | 0.230 | ||
| turn | 0.250 | ||
| sheet | 0.150 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146779.1 | internal | 179 | 3-539(+) |
Amino Acid sequence : | |||
| AAVIFLLFCLVVTLIVATEVPLAKVSGKGEQEQKVGFLDVFRSIRNLPPGMPSVLLITCLTWLSWFPFILYNTDWMGREVFHGDPKGSVAQIDAYDRGVREGAFGLLLNSIILGIGAFLI EPMCRKLTARVVWVVSNFMVSLVLAAMVILSFWSNHLYDGISTGPDSRVKAIALALFAA | |||
Physicochemical properties | |||
| Number of amino acids: | 179 | ||
| Molecular weight: | 11,770.016 | ||
| Theoretical pI: | 7.752 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18700 | ||
| Instability index: | 52.555 | ||
| aromaticity | 0.090 | ||
| GRAVY | -1.013 | ||
Secondary Structure Fraction | |||
| Helix | 0.230 | ||
| turn | 0.250 | ||
| sheet | 0.150 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146779.1 | complete | 100 | 470-168(-) |
Amino Acid sequence : | |||
| MIGPKTQYYHGSQDQRHHEVAYHPHYSCSEFSAHWLDQKGPNSENNRIQQQTKCTLSNTTIICINLCYRSLWIPMEDFTAHPIRVIEDKRKPRQPSETSN* | |||
Physicochemical properties | |||
| Number of amino acids: | 100 | ||
| Molecular weight: | 11,770.016 | ||
| Theoretical pI: | 7.752 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18700 | ||
| Instability index: | 52.555 | ||
| aromaticity | 0.090 | ||
| GRAVY | -1.013 | ||
Secondary Structure Fraction | |||
| Helix | 0.230 | ||
| turn | 0.250 | ||
| sheet | 0.150 | ||