| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146780.1 | internal | 155 | 1-465(+) |
Amino Acid sequence : | |||
| ATFLRVRPSKFDSFFGLFSIKMSIISFPTSCTIKCNFRTQSPYALAKGPTSLGSFKNVSKSFGLKQSSCFKATAMAVYKVKLVTPEGEEHEFEAPDDAYILDSAETAGLELPYSCRAGAC STCAGKIVSGSVDQSDGSFLDESQVENGYALTCVS | |||
Physicochemical properties | |||
| Number of amino acids: | 155 | ||
| Molecular weight: | 16,623.658 | ||
| Theoretical pI: | 5.856 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7825 | ||
| Instability index: | 47.553 | ||
| aromaticity | 0.110 | ||
| GRAVY | -0.030 | ||
Secondary Structure Fraction | |||
| Helix | 0.277 | ||
| turn | 0.277 | ||
| sheet | 0.232 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146780.1 | internal | 155 | 1-465(+) |
Amino Acid sequence : | |||
| ATFLRVRPSKFDSFFGLFSIKMSIISFPTSCTIKCNFRTQSPYALAKGPTSLGSFKNVSKSFGLKQSSCFKATAMAVYKVKLVTPEGEEHEFEAPDDAYILDSAETAGLELPYSCRAGAC STCAGKIVSGSVDQSDGSFLDESQVENGYALTCVS | |||
Physicochemical properties | |||
| Number of amino acids: | 155 | ||
| Molecular weight: | 16,623.658 | ||
| Theoretical pI: | 5.856 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7825 | ||
| Instability index: | 47.553 | ||
| aromaticity | 0.110 | ||
| GRAVY | -0.030 | ||
Secondary Structure Fraction | |||
| Helix | 0.277 | ||
| turn | 0.277 | ||
| sheet | 0.232 | ||