| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146799.1 | internal | 203 | 3-611(+) |
Amino Acid sequence : | |||
| VPFGKNYVPTWAFDHIKYFNGGNEIQLHLDKYTGTGFQSKGSYLFGHFSMQIKLVPGDSAGTVTAFYLSSQNSEHDEIDFEFLGNTTGQPYILQTNVFTGWQGNREQRIYLWFDPTKDYH SYSVLWNMYQIVFLVDDVPIRVFKNCKELGLRFPFNQPMKIYSSLWNADDWATRGGLVKTNWANAPFVASYRGFHVDGCEASV | |||
Physicochemical properties | |||
| Number of amino acids: | 203 | ||
| Molecular weight: | 17,804.354 | ||
| Theoretical pI: | 7.229 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
| Instability index: | 46.976 | ||
| aromaticity | 0.050 | ||
| GRAVY | -0.125 | ||
Secondary Structure Fraction | |||
| Helix | 0.346 | ||
| turn | 0.239 | ||
| sheet | 0.264 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146799.1 | 5prime_partial | 159 | 611-132(-) |
Amino Acid sequence : | |||
| DRGLAAVHMESSVRRNERGIGPVGLHQAAPRGPVIRVPKTGVDLHGLVERKTEAQFLAILEHSDGNIIYQEDNLVHVPEDRVGMIVLGWVEPEVNSLLSVSLPSGEHVRLQYIGLTCCVA KKLKVYLIMLRVLRREIESSDSSSRIPWNQFYLHAEVPK* | |||
Physicochemical properties | |||
| Number of amino acids: | 159 | ||
| Molecular weight: | 17,804.354 | ||
| Theoretical pI: | 7.229 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
| Instability index: | 46.976 | ||
| aromaticity | 0.050 | ||
| GRAVY | -0.125 | ||
Secondary Structure Fraction | |||
| Helix | 0.346 | ||
| turn | 0.239 | ||
| sheet | 0.264 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146799.1 | internal | 203 | 3-611(+) |
Amino Acid sequence : | |||
| VPFGKNYVPTWAFDHIKYFNGGNEIQLHLDKYTGTGFQSKGSYLFGHFSMQIKLVPGDSAGTVTAFYLSSQNSEHDEIDFEFLGNTTGQPYILQTNVFTGWQGNREQRIYLWFDPTKDYH SYSVLWNMYQIVFLVDDVPIRVFKNCKELGLRFPFNQPMKIYSSLWNADDWATRGGLVKTNWANAPFVASYRGFHVDGCEASV | |||
Physicochemical properties | |||
| Number of amino acids: | 203 | ||
| Molecular weight: | 17,804.354 | ||
| Theoretical pI: | 7.229 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
| Instability index: | 46.976 | ||
| aromaticity | 0.050 | ||
| GRAVY | -0.125 | ||
Secondary Structure Fraction | |||
| Helix | 0.346 | ||
| turn | 0.239 | ||
| sheet | 0.264 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146799.1 | 5prime_partial | 159 | 611-132(-) |
Amino Acid sequence : | |||
| DRGLAAVHMESSVRRNERGIGPVGLHQAAPRGPVIRVPKTGVDLHGLVERKTEAQFLAILEHSDGNIIYQEDNLVHVPEDRVGMIVLGWVEPEVNSLLSVSLPSGEHVRLQYIGLTCCVA KKLKVYLIMLRVLRREIESSDSSSRIPWNQFYLHAEVPK* | |||
Physicochemical properties | |||
| Number of amino acids: | 159 | ||
| Molecular weight: | 17,804.354 | ||
| Theoretical pI: | 7.229 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
| Instability index: | 46.976 | ||
| aromaticity | 0.050 | ||
| GRAVY | -0.125 | ||
Secondary Structure Fraction | |||
| Helix | 0.346 | ||
| turn | 0.239 | ||
| sheet | 0.264 | ||