| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146815.1 | 3prime_partial | 178 | 102-635(+) |
Amino Acid sequence : | |||
| MAKKLIQIDISSDTVCPWCFVGKKKLEKAMDMAKDQFDFEVRWHPFFLDASAPKEGIRKTEFYGKKFGATPFERMTSQMTEVFRGVGLEYDISGLTGNTLDSHRLINFAAHQGYDKQNAL VEELFLNYFCQGKYIGDRQVLLDAARKVGIEGAEEFLGNPSNGVNEVNEELEKYSSRI | |||
Physicochemical properties | |||
| Number of amino acids: | 178 | ||
| Molecular weight: | 20,252.779 | ||
| Theoretical pI: | 5.484 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20065 | ||
| Instability index: | 28.468 | ||
| aromaticity | 0.118 | ||
| GRAVY | -0.428 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.208 | ||
| sheet | 0.264 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146815.1 | 3prime_partial | 178 | 102-635(+) |
Amino Acid sequence : | |||
| MAKKLIQIDISSDTVCPWCFVGKKKLEKAMDMAKDQFDFEVRWHPFFLDASAPKEGIRKTEFYGKKFGATPFERMTSQMTEVFRGVGLEYDISGLTGNTLDSHRLINFAAHQGYDKQNAL VEELFLNYFCQGKYIGDRQVLLDAARKVGIEGAEEFLGNPSNGVNEVNEELEKYSSRI | |||
Physicochemical properties | |||
| Number of amino acids: | 178 | ||
| Molecular weight: | 20,252.779 | ||
| Theoretical pI: | 5.484 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20065 | ||
| Instability index: | 28.468 | ||
| aromaticity | 0.118 | ||
| GRAVY | -0.428 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.208 | ||
| sheet | 0.264 | ||