| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146833.1 | 5prime_partial | 136 | 2-412(+) |
Amino Acid sequence : | |||
| LPFFLGLERKGEILEREMAASAAVAEGAVIACHTTEECKQQLEQANISKKLVVVDFTATWCPPCRMIAPIFAELAKKFTDVIFLKVDVDELKDVAADWAVEAMPTFIFVKEGTIVDKIVG ALKDELPKKIEKHMSN* | |||
Physicochemical properties | |||
| Number of amino acids: | 136 | ||
| Molecular weight: | 13,901.896 | ||
| Theoretical pI: | 10.062 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5750 | ||
| Instability index: | 38.227 | ||
| aromaticity | 0.075 | ||
| GRAVY | 0.356 | ||
Secondary Structure Fraction | |||
| Helix | 0.261 | ||
| turn | 0.313 | ||
| sheet | 0.216 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146833.1 | 3prime_partial | 134 | 402-1(-) |
Amino Acid sequence : | |||
| MCFSIFFGSSSLRAPTILSTIVPSFTKIKVGIASTAQSAATSFNSSTSTLRKMTSVNFFASSAKIGAIMRHGGHQVAVKSTTTSFLDMLACSSCCLHSSVVWQAITAPSATAADAAISLS KISPFLSNPKKNGN | |||
Physicochemical properties | |||
| Number of amino acids: | 134 | ||
| Molecular weight: | 13,901.896 | ||
| Theoretical pI: | 10.062 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5750 | ||
| Instability index: | 38.227 | ||
| aromaticity | 0.075 | ||
| GRAVY | 0.356 | ||
Secondary Structure Fraction | |||
| Helix | 0.261 | ||
| turn | 0.313 | ||
| sheet | 0.216 | ||