| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146837.1 | 5prime_partial | 134 | 2-406(+) |
Amino Acid sequence : | |||
| HEIEAMTCGLPMFATAYGGPAEIIVDGVSGYHIDPYQGDKAAELLVDFFDKCKDDPTHWDKFSEQGLKRIEEKYTWKLYSERLMTLAGVYGFWKFVSKLDRRETRRYLEMFYALKYRNLA NSVPLAVDGEDDAK* | |||
Physicochemical properties | |||
| Number of amino acids: | 134 | ||
| Molecular weight: | 15,504.422 | ||
| Theoretical pI: | 5.207 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29910 30035 | ||
| Instability index: | 36.625 | ||
| aromaticity | 0.142 | ||
| GRAVY | -0.475 | ||
Secondary Structure Fraction | |||
| Helix | 0.321 | ||
| turn | 0.164 | ||
| sheet | 0.284 | ||