| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146852.1 | internal | 139 | 1-417(+) |
Amino Acid sequence : | |||
| SPGLQEFGTRLWQVPETLHEDILGKMSAPPKSEVPIITPNELAEADGLIFGFPTRFGMMAAQFKAFLDATGGLWRAQQLAGKPAGIFFSTGSQGGGQETTALTAITQLTHHGMIFVPIGY TFGAGMFEMEEVKGGSPYG | |||
Physicochemical properties | |||
| Number of amino acids: | 139 | ||
| Molecular weight: | 10,313.057 | ||
| Theoretical pI: | 8.745 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 500 | ||
| Instability index: | 80.370 | ||
| aromaticity | 0.029 | ||
| GRAVY | 0.511 | ||
Secondary Structure Fraction | |||
| Helix | 0.240 | ||
| turn | 0.433 | ||
| sheet | 0.231 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146852.1 | 3prime_partial | 104 | 314-3(-) |
Amino Acid sequence : | |||
| MAVNAVVSCPPPCDPVLKNIPAGFPASCCALQSPPVASRKALNCAAIMPNLVGNPKINPSASASSFGVMIGTSLLGGALIFPSMSSCRVSGTCHSLVPNSCSPG | |||
Physicochemical properties | |||
| Number of amino acids: | 104 | ||
| Molecular weight: | 10,313.057 | ||
| Theoretical pI: | 8.745 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 500 | ||
| Instability index: | 80.370 | ||
| aromaticity | 0.029 | ||
| GRAVY | 0.511 | ||
Secondary Structure Fraction | |||
| Helix | 0.240 | ||
| turn | 0.433 | ||
| sheet | 0.231 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146852.1 | internal | 139 | 1-417(+) |
Amino Acid sequence : | |||
| SPGLQEFGTRLWQVPETLHEDILGKMSAPPKSEVPIITPNELAEADGLIFGFPTRFGMMAAQFKAFLDATGGLWRAQQLAGKPAGIFFSTGSQGGGQETTALTAITQLTHHGMIFVPIGY TFGAGMFEMEEVKGGSPYG | |||
Physicochemical properties | |||
| Number of amino acids: | 139 | ||
| Molecular weight: | 10,313.057 | ||
| Theoretical pI: | 8.745 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 500 | ||
| Instability index: | 80.370 | ||
| aromaticity | 0.029 | ||
| GRAVY | 0.511 | ||
Secondary Structure Fraction | |||
| Helix | 0.240 | ||
| turn | 0.433 | ||
| sheet | 0.231 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146852.1 | 3prime_partial | 104 | 314-3(-) |
Amino Acid sequence : | |||
| MAVNAVVSCPPPCDPVLKNIPAGFPASCCALQSPPVASRKALNCAAIMPNLVGNPKINPSASASSFGVMIGTSLLGGALIFPSMSSCRVSGTCHSLVPNSCSPG | |||
Physicochemical properties | |||
| Number of amino acids: | 104 | ||
| Molecular weight: | 10,313.057 | ||
| Theoretical pI: | 8.745 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 500 | ||
| Instability index: | 80.370 | ||
| aromaticity | 0.029 | ||
| GRAVY | 0.511 | ||
Secondary Structure Fraction | |||
| Helix | 0.240 | ||
| turn | 0.433 | ||
| sheet | 0.231 | ||