Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146858.1 | internal | 132 | 2-397(+) |
Amino Acid sequence : | |||
PPGCRNSAPVNQNLERAVKENDRVYLMRVPAPGSLSALPSASLVKSVPMAEVLDASKERLFTGIVPDTSAKALSRYTEMVDDVIRTQAEKLQQASEITRVKLKEMDLPDSVLALEGSFSL PMDLKEDVEAVQ | |||
Physicochemical properties | |||
Number of amino acids: | 132 | ||
Molecular weight: | 11,157.637 | ||
Theoretical pI: | 8.866 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
Instability index: | 32.888 | ||
aromaticity | 0.047 | ||
GRAVY | 0.156 | ||
Secondary Structure Fraction | |||
Helix | 0.252 | ||
turn | 0.318 | ||
sheet | 0.290 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146858.1 | 5prime_partial | 107 | 396-73(-) |
Amino Acid sequence : | |||
CTASTSSLRSMGKLKLPSNASTESGRSISFNFTLVISLACCNFSACVRMTSSTISVYLERAFALVSGTIPVNNLSLLASKTSAMGTDLTREAEGRADNEPGAGTLIK* | |||
Physicochemical properties | |||
Number of amino acids: | 107 | ||
Molecular weight: | 11,157.637 | ||
Theoretical pI: | 8.866 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
Instability index: | 32.888 | ||
aromaticity | 0.047 | ||
GRAVY | 0.156 | ||
Secondary Structure Fraction | |||
Helix | 0.252 | ||
turn | 0.318 | ||
sheet | 0.290 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146858.1 | internal | 132 | 2-397(+) |
Amino Acid sequence : | |||
PPGCRNSAPVNQNLERAVKENDRVYLMRVPAPGSLSALPSASLVKSVPMAEVLDASKERLFTGIVPDTSAKALSRYTEMVDDVIRTQAEKLQQASEITRVKLKEMDLPDSVLALEGSFSL PMDLKEDVEAVQ | |||
Physicochemical properties | |||
Number of amino acids: | 132 | ||
Molecular weight: | 11,157.637 | ||
Theoretical pI: | 8.866 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
Instability index: | 32.888 | ||
aromaticity | 0.047 | ||
GRAVY | 0.156 | ||
Secondary Structure Fraction | |||
Helix | 0.252 | ||
turn | 0.318 | ||
sheet | 0.290 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146858.1 | 5prime_partial | 107 | 396-73(-) |
Amino Acid sequence : | |||
CTASTSSLRSMGKLKLPSNASTESGRSISFNFTLVISLACCNFSACVRMTSSTISVYLERAFALVSGTIPVNNLSLLASKTSAMGTDLTREAEGRADNEPGAGTLIK* | |||
Physicochemical properties | |||
Number of amino acids: | 107 | ||
Molecular weight: | 11,157.637 | ||
Theoretical pI: | 8.866 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
Instability index: | 32.888 | ||
aromaticity | 0.047 | ||
GRAVY | 0.156 | ||
Secondary Structure Fraction | |||
Helix | 0.252 | ||
turn | 0.318 | ||
sheet | 0.290 |